StarFunc result for job id Q8IWI9

User Input

>input (1400 residues)
MEEKQQIILANQDGGTVAGAAPTFFVILKQPGNGKTDQGILVTNQDACALASSVSSPVKS
KGKICLPADCTVGGITVTLDNNSMWNEFYHRSTEMILTKQGRRMFPYCRYWITGLDSNLK
YILVMDISPVDNHRYKWNGRWWEPSGKAEPHVLGRVFIHPESPSTGHYWMHQPVSFYKLK
LTNNTLDQEGHIILHSMHRYLPRLHLVPAEKAVEVIQLNGPGVHTFTFPQTEFFAVTAYQ
NIQITQLKIDYNPFAKGFRDDGLNNKPQRDGKQKNSSDQEGNNISSSSGHRVRLTEGQGS
EIQPGDLDPLSRGHETSGKGLEKTSLNIKRDFLGFMDTDSALSEVPQLKQEISECLIASS
FEDDSRVASPLDQNGSFNVVIKEEPLDDYDYELGECPEGVTVKQEETDEETDVYSNSDDD
PILEKQLKRHNKVDNPEADHLSSKWLPSSPSGVAKAKMFKLDTGKMPVVYLEPCAVTRST
VKISELPDNMLSTSRKDKSSMLAELEYLPTYIENSNETAFCLGKESENGLRKHSPDLRVV
QKYPLLKEPQWKYPDISDSISTERILDDSKDSVGDSLSGKEDLGRKRTTMLKIATAAKVV
NANQNASPNVPGKRGRPRKLKLCKAGRPPKNTGKSLISTKNTPVSPGSTFPDVKPDLEDV
DGVLFVSFESKEALDIHAVDGTTEESSSLQASTTNDSGYRARISQLEKELIEDLKTLRHK
QVIHPGLQEVGLKLNSVDPTMSIDLKYLGVQLPLAPATSFPFWNLTGTNPASPDAGFPFV
SRTGKTNDFTKIKGWRGKFHSASASRNEGGNSESSLKNRSAFCSDKLDEYLENEGKLMET
SMGFSSNAPTSPVVYQLPTKSTSYVRTLDSVLKKQSTISPSTSYSLKPHSVPPVSRKAKS
QNRQATFSGRTKSSYKSILPYPVSPKQKYSHVILGDKVTKNSSGIISENQANNFVVPTLD
ENIFPKQISLRQAQQQQQQQQGSRPPGLSKSQVKLMDLEDCALWEGKPRTYITEERADVS
LTTLLTAQASLKTKPIHTIIRKRAPPCNNDFCRLGCVCSSLALEKRQPAHCRRPDCMFGC
TCLKRKVVLVKGGSKTKHFQRKAAHRDPVFYDTLGEEAREEEEGIREEEEQLKEKKKRKK
LEYTICETEPEQPVRHYPLWVKVEGEVDPEPVYIPTPSVIEPMKPLLLPQPEVLSPTVKG
KLLTGIKSPRSYTPKPNPVIREEDKDPVYLYFESMMTCARVRVYERKKEDQRQPSSSSSP
SPSFQQQTSCHSSPENHNNAKEPDSEQQPLKQLTCDLEDDSDKLQEKSWKSSCNEGESSS
TSYMHQRSPGGPTKLIEIISDCNWEEDRNKILSILSQHINSNMPQSLKVGSFIIELASQR
KSRGEKNPPVYSSRVKISMP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8JIS6	0.137	0.218	1.139E-26	874	0.161	0.257	Q8JIS6.pdb.gz	TBX6_DANRE T-box transcription factor TBX6 OS=Danio rerio OX=7955 GN=tbx6 PE=2 SV=2
2	AFDB:P55965	0.133	0.251	3.416E-23	697	0.110	0.221	P55965.pdb.gz	BYN_DROME T-related protein OS=Drosophila melanogaster OX=7227 GN=byn PE=2 SV=2
3	AFDB:P39059	0.059	0.059	3.444E-4	1388	0.123	0.124	P39059.pdb.gz	COFA1_HUMAN Collagen alpha-1(XV) chain OS=Homo sapiens OX=9606 GN=COL15A1 PE=1 SV=2
4	AFDB:Q3TUF7	0.039	0.039	6.005E-4	1407	0.101	0.100	Q3TUF7.pdb.gz	YETS2_MOUSE YEATS domain-containing protein 2 OS=Mus musculus OX=10090 GN=Yeats2 PE=1 SV=2
5	AFDB:Q9ULM3	0.045	0.045	1.634E-3	1422	0.113	0.111	Q9ULM3.pdb.gz	YETS2_HUMAN YEATS domain-containing protein 2 OS=Homo sapiens OX=9606 GN=YEATS2 PE=1 SV=2
6	AFDB:Q2Q0I9	0.040	0.035	3.761E-3	1779	0.140	0.110	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
7	AFDB:Q0VF58	0.048	0.056	4.698E-3	1136	0.112	0.138	Q0VF58.pdb.gz	COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus OX=10090 GN=Col19a1 PE=2 SV=2
8	AFDB:Q53SF7	0.039	0.044	4.698E-3	1128	0.126	0.157	Q53SF7.pdb.gz	COBL1_HUMAN Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=3
9	AFDB:Q9V727	0.035	0.032	6.559E-3	1669	0.132	0.111	Q9V727.pdb.gz	ASX_DROME Polycomb protein Asx OS=Drosophila melanogaster OX=7227 GN=Asx PE=1 SV=1
10	AFDB:Q59IW9	0.041	0.050	1.144E-2	1079	0.095	0.123	Q59IW9.pdb.gz	Q59IW9_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
11	PDB:6cfwK	0.034	0.244	6.062E-2	166	0.006	0.048	6cfwK.pdb.gz	Structure of an Ancient Respiratory System.
12	PDB:7b0xC	0.047	0.214	6.062E-2	211	0.011	0.071	7b0xC.pdb.gz
13	PDB:3b2dC	0.042	0.281	9.458E-2	139	0.010	0.101	3b2dC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
14	PDB:3t6qC	0.051	0.295	1.057E-1	139	0.016	0.158	3t6qC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
15	PDB:7p2pB	0.040	0.147	1.476E-1	179	0.015	0.117	7p2pB.pdb.gz
16	PDB:1ddtA	0.063	0.144	1.843E-1	523	0.016	0.044	1ddtA.pdb.gz	Refined structure of dimeric diphtheria toxin at 2.0 A resolution.
17	PDB:6iggA	0.059	0.313	2.178E-1	170	0.019	0.159	6iggA.pdb.gz
18	PDB:6xreM	0.057	0.200	2.302E-1	314	0.016	0.073	6xreM.pdb.gz	Structure of the p53/RNA polymerase II assembly.
19	PDB:5mhlA	0.053	0.090	2.434E-1	692	0.007	0.014	5mhlA.pdb.gz	Structure of active coagulation factor XIII triggered by calcium binding: basis for the design of next-generation anticoagulants.
20	PDB:5w3sA	0.031	0.073	2.573E-1	485	0.007	0.021	5w3sA.pdb.gz	Cryo-electron microscopy structure of the lysosomal calcium-permeable channel TRPML3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AWL7	0.0	2413	3003	0.864	0.403	MGAP_MOUSE MAX gene-associated protein OS=Mus musculus OX=10090 GN=Mga PE=2 SV=1
2	Q8IWI9	0.0	2933	3065	1.000	0.457	MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens OX=9606 GN=MGA PE=1 SV=4
3	F1R7N7	9.60e-97	347	2735	0.195	0.100	F1R7N7_DANRE MAX dimerization protein MGA a OS=Danio rerio OX=7955 GN=im:7137698 PE=4 SV=1
4	D2JVK2	2.63e-95	342	2735	0.194	0.099	D2JVK2_DANRE Max gene-associated protein OS=Danio rerio OX=7955 GN=sb:eu601 PE=2 SV=1
5	O95947	1.94e-69	242	436	0.081	0.261	TBX6_HUMAN T-box transcription factor TBX6 OS=Homo sapiens OX=9606 GN=TBX6 PE=1 SV=2
6	P70327	9.00e-69	240	436	0.081	0.259	TBX6_MOUSE T-box transcription factor TBX6 OS=Mus musculus OX=10090 GN=Tbx6 PE=2 SV=2
7	Q8AV66	1.11e-68	243	506	0.081	0.223	TBX6_XENLA T-box transcription factor TBX6 OS=Xenopus laevis OX=8355 GN=tbx6 PE=1 SV=2
8	P79742	2.68e-67	237	473	0.077	0.228	TBX6L_DANRE T-box transcription factor TBX6L OS=Danio rerio OX=7955 GN=tbx6l PE=2 SV=1
9	O93389	5.32e-67	236	470	0.086	0.255	O93389_DANRE Spadetail OS=Danio rerio OX=7955 GN=spt PE=2 SV=1
10	P87377	2.07e-64	228	455	0.079	0.242	VEGTA_XENLA T-box protein VegT-A OS=Xenopus laevis OX=8355 GN=vegt-a PE=1 SV=2
11	Q8MYX3	9.98e-63	221	391	0.075	0.269	Q8MYX3_DROME RE59988p OS=Drosophila melanogaster OX=7227 GN=Doc1 PE=2 SV=1
12	M9PBY6	1.42e-62	220	356	0.074	0.292	M9PBY6_DROME Dorsocross1, isoform B OS=Drosophila melanogaster OX=7227 GN=Doc1 PE=4 SV=1
13	Q9U8L5	3.74e-62	220	391	0.074	0.266	Q9U8L5_DROME Dorsocross1, isoform A OS=Drosophila melanogaster OX=7227 GN=Doc1 PE=2 SV=1
14	Q9VST2	2.58e-61	220	469	0.080	0.239	Q9VST2_DROME Dorsocross2 OS=Drosophila melanogaster OX=7227 GN=Doc2 PE=2 SV=1
15	Q8JIS6	7.40e-61	228	874	0.075	0.120	TBX6_DANRE T-box transcription factor TBX6 OS=Danio rerio OX=7955 GN=tbx6 PE=2 SV=2
16	Q13207	3.68e-59	220	712	0.074	0.146	TBX2_HUMAN T-box transcription factor TBX2 OS=Homo sapiens OX=9606 GN=TBX2 PE=1 SV=3
17	O93288	8.52e-59	214	541	0.089	0.231	O93288_CHICK T-Box protein 4 OS=Gallus gallus OX=9031 GN=TBX4 PE=1 SV=1
18	Q9IAK8	9.13e-59	213	492	0.074	0.211	TBX5A_DANRE T-box transcription factor TBX5-A OS=Danio rerio OX=7955 GN=tbx5a PE=2 SV=2
19	Q60707	1.15e-58	218	711	0.074	0.146	TBX2_MOUSE T-box transcription factor TBX2 OS=Mus musculus OX=10090 GN=Tbx2 PE=1 SV=3
20	Q8T6Q0	1.20e-58	211	424	0.074	0.243	Q8T6Q0_DROME Dorsocross3 OS=Drosophila melanogaster OX=7227 GN=Doc3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16059 MGA_dom	1.2e-10	52.6	MGA, conserved domain
2	PF00907 T-box	1e-68	242.4	T-box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219905

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370936	0.991	Transcription factor E2F6
2	9606.ENSP00000351446	0.987	WD repeat-containing protein 5
3	9606.ENSP00000351490	0.985	Protein max
4	9606.ENSP00000356480	0.970	E3 ubiquitin-protein ligase RING2
5	9606.ENSP00000358862	0.960	Polycomb group RING finger protein 6
6	9606.ENSP00000216237	0.947	Lethal(3)malignant brain tumor-like protein 2
7	9606.ENSP00000436786	0.926	Histone-lysine N-methyltransferase 2A
8	9606.ENSP00000345571	0.922	Transcription factor E2F1
9	9606.ENSP00000382863	0.920	Chromodomain-helicase-DNA-binding protein 8
10	9606.ENSP00000406549	0.919	Transcription initiation factor TFIID subunit 1
11	9606.ENSP00000264515	0.906	Retinoblastoma-binding protein 5
12	9606.ENSP00000301396	0.906	Proline-, glutamic acid- and leucine-rich protein 1
13	9606.ENSP00000473172	0.906	RuvB-like 2
14	9606.ENSP00000363124	0.905	PHD finger protein 20
15	9606.ENSP00000252996	0.904	Transcription initiation factor TFIID subunit 4
16	9606.ENSP00000399982	0.904	Transcription initiation factor TFIID subunit 6
17	9606.ENSP00000309555	0.903	Host cell factor 1
18	9606.ENSP00000318297	0.903	RuvB-like 1
19	9606.ENSP00000406037	0.903	Histone acetyltransferase KAT8
20	9606.ENSP00000370201	0.902	Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. AMP and dAMP are the preferred substrates, but CMP and dCMP are also good substrates. IMP is phosphorylated to a much lesser extent. All nucleoside triphosphates ATP, GTP, UTP, CTP, dATP, dCTP, dGTP, and TTP are accepted as phosphate donors. CTP is the best phosphate donor, followed by UTP, ATP, GTP and dCTP. May have a role in nuclear energy homeostasis. Has also ATPase activity. May be involved in regulatio [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0140110	0.988	transcription regulator activity
GO:0003700	0.976	DNA-binding transcription factor activity
GO:0000981	0.958	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.989	positive regulation of biological process
GO:0010468	0.987	regulation of gene expression
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0006355	0.968	regulation of DNA-templated transcription
GO:0048522	0.965	positive regulation of cellular process
GO:0009893	0.936	positive regulation of metabolic process
GO:0051173	0.929	positive regulation of nitrogen compound metabolic process
GO:0031325	0.929	positive regulation of cellular metabolic process
GO:0010604	0.928	positive regulation of macromolecule metabolic process
GO:0009987	0.906	cellular process
GO:0006357	0.886	regulation of transcription by RNA polymerase II
GO:0045893	0.848	positive regulation of DNA-templated transcription
GO:0045944	0.842	positive regulation of transcription by RNA polymerase II
GO:0050896	0.835	response to stimulus
GO:1990823	0.688	response to leukemia inhibitory factor
GO:0051716	0.681	cellular response to stimulus
GO:0070887	0.616	cellular response to chemical stimulus
GO:0071310	0.512	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0005654	0.997	nucleoplasm
GO:0071339	0.907	MLL1 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]