StarFunc result for job id Q8IWJ2

User Input

>input (1684 residues)
MEDLVQDGVASPATPGTGKSKLETLPKEDLIKFAKKQMMLIQKAKSRCTELEKEIEELRS
KPVTEGTGDIIKALTERLDALLLEKAETEQQCLSLKKENIKMKQEVEDSVTKMGDAHKEL
EQSHINYVKEIENLKNELMAVRSKYSEDKANLQKQLEEAMNTQLELSEQLKFQNNSEDNV
KKLQEEIEKIRPGFEEQILYLQKQLDATTDEKKETVTQLQNIIEANSQHYQKNINSLQEE
LLQLKAIHQEEVKELMCQIEASAKEHEAEINKLNELKENLVKQCEASEKNIQKKYECELE
NLRKATSNANQDNQICSILLQENTFVEQVVNEKVKHLEDTLKELESQHSILKDEVTYMNN
LKLKLEMDAQHIKDEFFHEREDLEFKINELLLAKEEQGCVIEKLKSELAGLNKQFCYTVE
QHNREVQSLKEQHQKEISELNETFLSDSEKEKLTLMFEIQGLKEQCENLQQEKQEAILNY
ESLREIMEILQTELGESAGKISQEFESMKQQQASDVHELQQKLRTAFTEKDALLETVNRL
QGENEKLLSQQELVPELENTIKNLQEKNGVYLLSLSQRDTMLKELEGKINSLTEEKDDFI
NKLKNSHEEMDNFHKKCEREERLILELGKKVEQTIQYNSELEQKVNELTGGLEETLKEKD
QNDQKLEKLMVQMKVLSEDKEVLSAEVKSLYEENNKLSSEKKQLSRDLEVFLSQKEDVIL
KEHITQLEKKLQLMVEEQDNLNKLLENEQVQKLFVKTQLYGFLKEMGSEVSEDSEEKDVV
NVLQAVGESLAKINEEKCNLAFQRDEKVLELEKEIKCLQEESVVQCEELKSLLRDYEQEK
VLLRKELEEIQSEKEALQSDLLEMKNANEKTRLENQNLLIQVEEVSQTCSKSEIHNEKEK
CFIKEHENLKPLLEQKELRDRRAELILLKDSLAKSPSVKNDPLSSVKELEEKIENLEKEC
KEKEEKINKIKLVAVKAKKELDSSRKETQTVKEELESLRSEKDQLSASMRDLIQGAESYK
NLLLEYEKQSEQLDVEKERANNFEHRIEDLTRQLRNSTLQCETINSDNEDLLARIETLQS
NAKLLEVQILEVQRAKAMVDKELEAEKLQKEQKIKEHATTVNELEELQVQLQKQKKQLQK
TMQELELVKKDAQQTTLMNMEIADYERLMKELNQKLTNKNNKIEDLEQEIKIQKQKQETL
QEEITSLQSSVQQYEEKNTKIKQLLVKTKKELADSKQAETDHLILQASLKGELEASQQQV
EVYKIQLAEITSEKHKIHEHLKTSAEQHQRTLSAYQQRVTALQEECRAAKAEQATVTSEF
ESYKVRVHNVLKQQKNKSMSQAETEGAKQEREHLEMLIDQLKIKLQDSQNNLQINVSELQ
TLQSEHDTLLERHNKMLQETVSKEAELREKLCSIQSENMMMKSEHTQTVSQLTSQNEVLR
NSFRDQVRHLQEEHRKTVETLQQQLSKMEAQLFQLKNEPTTRSPVSSQQSLKNLRERRNT
DLPLLDMHTVTREEGEGMETTDTESVSSASTYTQSLEQLLNSPETKLEPPLWHAEFTKEE
LVQKLSSTTKSADHLNGLLRETEATNAILMEQIKLLKSEIRRLERNQEREKSAANLEYLK
NVLLQFIFLKPGSERERLLPVINTMLQLSPEEKGKLAAVAQGEEENASRSSGWASYLHSW
SGLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CHG3	0.220	0.220	0.000	1679	0.779	0.781	Q8CHG3.pdb.gz	GCC2_MOUSE GRIP and coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gcc2 PE=1 SV=3
2	AFDB:Q8IWJ2	1.000	1.000	0.000	1684	1.000	1.000	Q8IWJ2.pdb.gz	GCC2_HUMAN GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4
3	AFDB:Q9VGE4	0.108	0.154	9.749E-12	1135	0.138	0.204	Q9VGE4.pdb.gz	Q9VGE4_DROME FI04457p OS=Drosophila melanogaster OX=7227 GN=GCC185 PE=1 SV=3
4	AFDB:Q8N4C6	0.083	0.069	6.178E-5	2090	0.180	0.145	Q8N4C6.pdb.gz	NIN_HUMAN Ninein OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=4
5	AFDB:O74424	0.092	0.086	3.201E-3	1837	0.175	0.160	O74424.pdb.gz	NU211_SCHPO Nucleoporin nup211 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup211 PE=1 SV=1
6	AFDB:Q9UTK5	0.075	0.073	3.201E-3	1727	0.182	0.177	Q9UTK5.pdb.gz	ALM1_SCHPO Nucleoporin alm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alm1 PE=1 SV=1
7	AFDB:Q8S2T0	0.052	0.104	3.887E-3	788	0.099	0.212	Q8S2T0.pdb.gz	GRIP_ARATH Protein GRIP OS=Arabidopsis thaliana OX=3702 GN=GRIP PE=1 SV=2
8	AFDB:I3ISQ9	0.062	0.057	5.036E-3	1954	0.182	0.157	I3ISQ9.pdb.gz
9	AFDB:E9Q7G0	0.077	0.066	1.095E-2	2094	0.167	0.134	E9Q7G0.pdb.gz	NUMA1_MOUSE Nuclear mitotic apparatus protein 1 OS=Mus musculus OX=10090 GN=Numa1 PE=1 SV=1
10	AFDB:Q61043	0.070	0.060	1.168E-2	2113	0.185	0.147	Q61043.pdb.gz	NIN_MOUSE Ninein OS=Mus musculus OX=10090 GN=Nin PE=1 SV=4
11	PDB:2b5uA	0.028	0.068	3.666	470	0.007	0.026	2b5uA.pdb.gz
12	PDB:6ygbB	0.025	0.051	3.666	725	0.005	0.012	6ygbB.pdb.gz	Divergent architecture of the heterotrimeric NatC complex explains N-terminal acetylation of cognate substrates.
13	PDB:1u2mC	0.031	0.234	4.452	143	0.007	0.077	1u2mC.pdb.gz
14	PDB:2jmhA	0.025	0.243	4.452	117	0.009	0.128	2jmhA.pdb.gz
15	PDB:3mayC	0.022	0.206	4.452	97	0.012	0.216	3mayC.pdb.gz
16	PDB:6eznE	0.024	0.256	4.452	85	0.005	0.094	6eznE.pdb.gz	Molecular basis for glycan recognition and reaction priming of eukaryotic oligosaccharyltransferase.
17	PDB:7rroA1	0.031	0.081	4.452	396	0.013	0.056	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:6hivAg	0.029	0.137	5.067	259	0.014	0.093	6hivAg.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:2ymbD	0.024	0.149	5.406	231	0.005	0.035	2ymbD.pdb.gz	Escrt-III Binding Protein Mitd1 is Involved in Cytokinesis and Has an Unanticipated Pld Fold that Binds Membranes.
20	PDB:7r5jV0	0.032	0.136	5.406	273	0.023	0.143	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8ZZW2	0.0	1781	916	0.544	1.000	B8ZZW2_HUMAN GRIP and coiled-coil domain containing 2 (Fragment) OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=1
2	Q8CHG3	0.0	2538	1680	0.780	0.782	GCC2_MOUSE GRIP and coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gcc2 PE=1 SV=3
3	Q8IWJ2	0.0	3309	1684	1.000	1.000	GCC2_HUMAN GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4
4	Q9VGE4	4.67e-15	83.6	1135	0.091	0.135	Q9VGE4_DROME FI04457p OS=Drosophila melanogaster OX=7227 GN=GCC185 PE=1 SV=3
5	Q96CN9	4.84e-05	50.8	775	0.017	0.036	GCC1_HUMAN GRIP and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GCC1 PE=1 SV=1
6	Q9VGR1	5.70e-05	50.4	695	0.015	0.036	Q9VGR1_DROME GRIP and coiled-coil domain containing 88 kDa OS=Drosophila melanogaster OX=7227 GN=GCC88 PE=2 SV=1
7	Q6PAK0	0.003	45.1	772	0.055	0.120	Q6PAK0_MOUSE Golgb1 protein (Fragment) OS=Mus musculus OX=10090 GN=Golgb1 PE=2 SV=1
8	Q8CGE5	0.014	42.7	1071	0.059	0.093	Q8CGE5_MOUSE Golgb1 protein (Fragment) OS=Mus musculus OX=10090 GN=Golgb1 PE=2 SV=1
9	Q03427	0.057	40.4	621	0.044	0.119	LAMC_DROME Lamin-C OS=Drosophila melanogaster OX=7227 GN=LamC PE=1 SV=2
10	M9PFJ2	0.36	38.1	2831	0.026	0.016	M9PFJ2_DROME Pericentrin-like protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Plp PE=1 SV=1
11	Q6AW69	0.47	37.7	1297	0.031	0.040	CGNL1_MOUSE Cingulin-like protein 1 OS=Mus musculus OX=10090 GN=Cgnl1 PE=1 SV=3
12	A0A286Y8J7	0.69	37.4	2675	0.063	0.040	A0A286Y8J7_DANRE Centromere protein F OS=Danio rerio OX=7955 GN=cenpf PE=1 SV=1
13	F1Q7X5	0.77	37.0	2708	0.063	0.039	F1Q7X5_DANRE Centromere protein F OS=Danio rerio OX=7955 GN=cenpf PE=1 SV=2
14	P07942	0.78	37.0	1786	0.026	0.025	LAMB1_HUMAN Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2
15	G3V7L1	0.91	37.0	3419	0.021	0.010	UTRN_RAT Utrophin OS=Rattus norvegicus OX=10116 GN=Utrn PE=1 SV=3
16	A0A0G2JW60	0.95	37.0	3424	0.021	0.010	A0A0G2JW60_RAT Utrophin OS=Rattus norvegicus OX=10116 GN=Utrn PE=1 SV=1
17	P46939	1.4	36.2	3433	0.022	0.011	UTRN_HUMAN Utrophin OS=Homo sapiens OX=9606 GN=UTRN PE=1 SV=2
18	P05661	1.6	36.2	1962	0.061	0.052	MYSA_DROME Myosin heavy chain, muscle OS=Drosophila melanogaster OX=7227 GN=Mhc PE=1 SV=4
19	Q9D0F1	1.7	35.8	642	0.043	0.112	NDC80_MOUSE Kinetochore protein NDC80 homolog OS=Mus musculus OX=10090 GN=Ndc80 PE=1 SV=1
20	Q0VF96	2.2	35.4	1302	0.018	0.023	CGNL1_HUMAN Cingulin-like protein 1 OS=Homo sapiens OX=9606 GN=CGNL1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00038 Filament	0.099	23.8	Intermediate filament protein
2	PF13851 GAS	16	16.3	Growth-arrest specific micro-tubule binding
3	PF01465 GRIP	8.7e-15	65.6	GRIP domain
4	PF16704 Rab_bind	3.6e-36	134.3	Rab binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307939

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311449	0.998	Ras-related protein Rab-6A
2	9606.ENSP00000349305	0.951	Golgin subfamily A member 4
3	9606.ENSP00000261636	0.947	ADP-ribosylation factor-like protein 1
4	9606.ENSP00000362656	0.947	Golgin subfamily A member 1
5	9606.ENSP00000466298	0.944	Syntaxin-10
6	9606.ENSP00000319781	0.930	Ras-related protein Rab-43
7	9606.ENSP00000360183	0.927	Syntaxin-16
8	9606.ENSP00000420127	0.911	Ras-related protein Rab-9A
9	9606.ENSP00000381098	0.909	Glutamate receptor-interacting protein 1
10	9606.ENSP00000376792	0.902	Vesicle transport through interaction with t-SNAREs homolog 1A
11	9606.ENSP00000417518	0.869	CLIP-associating protein 2
12	9606.ENSP00000258301	0.867	Syntaxin-6
13	9606.ENSP00000283195	0.854	E3 SUMO-protein ligase RanBP2
14	9606.ENSP00000386443	0.851	Trans-Golgi network integral membrane protein 2
15	9606.ENSP00000243298	0.850	Ras-related protein Rab-9B
16	9606.ENSP00000221455	0.844	CLK4-associating serine/arginine rich protein
17	9606.ENSP00000221957	0.834	Perilipin-3
18	9606.ENSP00000262646	0.804	Ras-related protein Rab-2A
19	9606.ENSP00000267622	0.804	Thyroid receptor-interacting protein 11
20	9606.ENSP00000236192	0.803	Vesicle-associated membrane protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.997	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0046907	0.984	intracellular transport
GO:0016192	0.975	vesicle-mediated transport
GO:0050789	0.969	regulation of biological process
GO:0071840	0.960	cellular component organization or biogenesis
GO:0050794	0.952	regulation of cellular process
GO:0008104	0.946	protein localization
GO:0016043	0.944	cellular component organization
GO:0071705	0.942	nitrogen compound transport
GO:0071702	0.938	organic substance transport
GO:0016482	0.935	cytosolic transport
GO:0010256	0.934	endomembrane system organization
GO:0006996	0.920	organelle organization
GO:0033365	0.912	protein localization to organelle
GO:0045184	0.912	establishment of protein localization
GO:0015031	0.861	protein transport
GO:0016197	0.849	endosomal transport
GO:0042147	0.844	retrograde transport, endosome to Golgi
GO:0007017	0.783	microtubule-based process
GO:0006886	0.773	intracellular protein transport
GO:0007034	0.730	vacuolar transport
GO:0072594	0.717	establishment of protein localization to organelle
GO:0048193	0.677	Golgi vesicle transport
GO:0007030	0.631	Golgi organization
GO:0072665	0.621	protein localization to vacuole
GO:0072666	0.518	establishment of protein localization to vacuole
GO:0032879	0.494	regulation of localization
GO:0051049	0.393	regulation of transport
GO:0000226	0.350	microtubule cytoskeleton organization
GO:0032880	0.326	regulation of protein localization
GO:0034067	0.326	protein localization to Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0016020	0.998	membrane
GO:0031984	0.985	organelle subcompartment
GO:0005802	0.982	trans-Golgi network
GO:0031090	0.849	organelle membrane
GO:0043232	0.323	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]