StarFunc result for job id Q8IWK6

User Input

>input (1321 residues)
MEPPGRRRGRAQPPLLLPLSLLALLALLGGGGGGGAAALPAGCKHDGRPRGAGRAAGAAE
GKVVCSSLELAQVLPPDTLPNRTVTLILSNNKISELKNGSFSGLSLLERLDLRNNLISSI
DPGAFWGLSSLKRLDLTNNRIGCLNADIFRGLTNLVRLNLSGNLFSSLSQGTFDYLASLR
SLEFQTEYLLCDCNILWMHRWVKEKNITVRDTRCVYPKSLQAQPVTGVKQELLTCDPPLE
LPSFYMTPSHRQVVFEGDSLPFQCMASYIDQDMQVLWYQDGRIVETDESQGIFVEKNMIH
NCSLIASALTISNIQAGSTGNWGCHVQTKRGNNTRTVDIVVLESSAQYCPPERVVNNKGD
FRWPRTLAGITAYLQCTRNTHGSGIYPGNPQDERKAWRRCDRGGFWADDDYSRCQYANDV
TRVLYMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSK
ELGDVMVDIASNIMLADERVLWLAQREAKACSRIVQCLQRIATYRLAGGAHVYSTYSPNI
ALEAYVIKSTGFTGMTCTVFQKVAASDRTGLSDYGRRDPEGNLDKQLSFKCNVSNTFSSL
ALKNTIVEASIQLPPSLFSPKQKRELRPTDDSLYKLQLIAFRNGKLFPATGNSTNLADDG
KRRTVVTPVILTKIDGVNVDTHHIPVNVTLRRIAHGADAVAARWDFDLLNGQGGWKSDGC
HILYSDENITTIQCYSLSNYAVLMDLTGSELYTQAASLLHPVVYTTAIILLLCLLAVIVS
YIYHHSLIRISLKSWHMLVNLCFHIFLTCVVFVGGITQTRNASICQAVGIILHYSTLATV
LWVGVTARNIYKQVTKKAKRCQDPDEPPPPPRPMLRFYLIGGGIPIIVCGITAAANIKNY
GSRPNAPYCWMAWEPSLGAFYGPASFITFVNCMYFLSIFIQLKRHPERKYELKEPTEEQQ
RLAANENGEINHQDSMSLSLISTSALENEHTFHSQLLGASLTLLLYVALWMFGALAVSLY
YPLDLVFSFVFGATSLSFSAFFVVHHCVNREDVRLAWIMTCCPGRSSYSVQVNVQPPNSN
GTNGEAPKCPNSSAESSCTNKSASSFKNSSQGCKLTNLQAAAAQCHANSLPLNSTPQLDN
SLTEHSMDNDIKMHVAPLEVQFRTNVHSSRHHKNRSKGHRASRLTVLREYAYDVPTSVEG
SVQNGLPKSRLGNNEGHSRSRRAYLAYRERQYNPPQQDSSDACSTLPKSSRNFEKPVSTT
SKKDALRKPAVVELENQQKSYGLNLAIQNGPIKSNGQEGPLLGTDSTGNVRTGLWKHETT
V

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7FBY6	0.645	0.626	0.000	1367	0.394	0.381	E7FBY6.pdb.gz	AGRA2_DANRE Adhesion G protein-coupled receptor A2 OS=Danio rerio OX=7955 GN=adgra2 PE=1 SV=2
2	AFDB:Q8IWK6	1.000	1.000	0.000	1321	1.000	1.000	Q8IWK6.pdb.gz	AGRA3_HUMAN Adhesion G protein-coupled receptor A3 OS=Homo sapiens OX=9606 GN=ADGRA3 PE=1 SV=2
3	AFDB:Q96PE1	0.667	0.660	0.000	1338	0.435	0.430	Q96PE1.pdb.gz	AGRA2_HUMAN Adhesion G protein-coupled receptor A2 OS=Homo sapiens OX=9606 GN=ADGRA2 PE=1 SV=2
4	AFDB:S4X0Q8	0.667	0.656	0.000	1346	0.637	0.625	S4X0Q8.pdb.gz	AGRA3_DANRE Adhesion G protein-coupled receptor A3 OS=Danio rerio OX=7955 GN=adgra3 PE=1 SV=1
5	AFDB:Q8C4G9	0.225	0.498	4.147E-35	578	0.191	0.436	Q8C4G9.pdb.gz	AGRA1_MOUSE Adhesion G protein-coupled receptor A1 OS=Mus musculus OX=10090 GN=Adgra1 PE=2 SV=1
6	AFDB:Q86SQ6	0.224	0.512	8.809E-34	560	0.187	0.441	Q86SQ6.pdb.gz	AGRA1_HUMAN Adhesion G protein-coupled receptor A1 OS=Homo sapiens OX=9606 GN=ADGRA1 PE=2 SV=3
7	PDB:5y31B	0.137	0.327	1.574E-12	511	0.057	0.147	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
8	AFDB:Q3V1M1	0.135	0.081	6.065E-8	2594	0.132	0.067	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
9	PDB:1xcdA	0.102	0.406	4.428E-6	305	0.039	0.167	1xcdA.pdb.gz
10	AFDB:O55005	0.069	0.055	6.532E-6	1651	0.110	0.088	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
11	AFDB:Q9W213	0.060	0.056	7.187E-6	1395	0.075	0.071	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
12	PDB:4edqA	0.073	0.190	1.046E-5	483	0.020	0.054	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
13	PDB:4k5yC	0.147	0.666	1.207E-5	248	0.035	0.185	4k5yC.pdb.gz	Structure of class B GPCR corticotropin-releasing factor receptor 1.
14	AFDB:Q9VQW7	0.067	0.066	1.215E-5	1332	0.086	0.085	Q9VQW7.pdb.gz	Q9VQW7_DROME Echinoid, isoform A OS=Drosophila melanogaster OX=7227 GN=ed PE=1 SV=2
15	PDB:7tynR	0.153	0.465	2.990E-5	373	0.036	0.129	7tynR.pdb.gz	A structural basis for amylin receptor phenotype.
16	PDB:6dldD	0.067	0.272	3.797E-5	269	0.024	0.119	6dldD.pdb.gz
17	PDB:7xt8R	0.145	0.531	7.063E-5	294	0.037	0.167	7xt8R.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
18	PDB:2ft3F	0.083	0.349	7.408E-5	305	0.033	0.141	2ft3F.pdb.gz
19	PDB:7wv3A	0.106	0.202	7.771E-5	668	0.034	0.067	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
20	PDB:1e07A	0.077	0.137	9.866E-5	642	0.039	0.079	1e07A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0U2ULT4	0.0	872	1367	0.401	0.388	A0A0U2ULT4_DANRE Adhesion G protein-coupled receptor A2 precursor OS=Danio rerio OX=7955 GN=adgra2 PE=1 SV=1
2	E7FBY6	0.0	879	1367	0.347	0.336	AGRA2_DANRE Adhesion G protein-coupled receptor A2 OS=Danio rerio OX=7955 GN=adgra2 PE=1 SV=2
3	Q7TT36	0.0	2465	1310	0.914	0.922	AGRA3_MOUSE Adhesion G protein-coupled receptor A3 OS=Mus musculus OX=10090 GN=Adgra3 PE=2 SV=3
4	Q8IWK6	0.0	2753	1321	1.000	1.000	AGRA3_HUMAN Adhesion G protein-coupled receptor A3 OS=Homo sapiens OX=9606 GN=ADGRA3 PE=1 SV=2
5	Q91ZV8	0.0	970	1336	0.429	0.424	AGRA2_MOUSE Adhesion G protein-coupled receptor A2 OS=Mus musculus OX=10090 GN=Adgra2 PE=1 SV=2
6	Q96PE1	0.0	944	1338	0.425	0.419	AGRA2_HUMAN Adhesion G protein-coupled receptor A2 OS=Homo sapiens OX=9606 GN=ADGRA2 PE=1 SV=2
7	S4X0Q8	0.0	1637	1346	0.645	0.633	AGRA3_DANRE Adhesion G protein-coupled receptor A3 OS=Danio rerio OX=7955 GN=adgra3 PE=1 SV=1
8	Q8C4G9	1.89e-133	424	578	0.188	0.431	AGRA1_MOUSE Adhesion G protein-coupled receptor A1 OS=Mus musculus OX=10090 GN=Adgra1 PE=2 SV=1
9	Q86SQ6	7.21e-133	421	560	0.188	0.445	AGRA1_HUMAN Adhesion G protein-coupled receptor A1 OS=Homo sapiens OX=9606 GN=ADGRA1 PE=2 SV=3
10	Q8IZF6	5.47e-28	125	3080	0.091	0.039	AGRG4_HUMAN Adhesion G-protein coupled receptor G4 OS=Homo sapiens OX=9606 GN=ADGRG4 PE=1 SV=2
11	Q6P1C6	3.89e-26	119	1117	0.060	0.071	LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus OX=10090 GN=Lrig3 PE=1 SV=1
12	Q6UXM1	8.61e-26	118	1119	0.060	0.071	LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens OX=9606 GN=LRIG3 PE=1 SV=1
13	Q9NYQ6	7.50e-25	115	3014	0.067	0.030	CELR1_HUMAN Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens OX=9606 GN=CELSR1 PE=1 SV=1
14	A0A6I8PRU0	8.02e-25	115	3019	0.067	0.029	A0A6I8PRU0_HUMAN Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens OX=9606 GN=CELSR1 PE=1 SV=2
15	F1R9W4	4.65e-24	113	3044	0.103	0.045	F1R9W4_DANRE Cadherin EGF LAG seven-pass G-type receptor 1 isoform X2 OS=Danio rerio OX=7955 GN=celsr1a PE=1 SV=3
16	O35161	3.08e-23	110	3034	0.081	0.035	CELR1_MOUSE Cadherin EGF LAG seven-pass G-type receptor 1 OS=Mus musculus OX=10090 GN=Celsr1 PE=1 SV=3
17	F1QBS8	6.56e-23	109	3006	0.072	0.032	F1QBS8_DANRE Cadherin EGF LAG seven-pass G-type receptor 1 OS=Danio rerio OX=7955 GN=celsr1b PE=3 SV=1
18	D2XV92	6.71e-23	108	1513	0.051	0.045	D2XV92_CHICK SLIT1 (Fragment) OS=Gallus gallus OX=9031 GN=SLIT1 PE=2 SV=1
19	Q9Z173	1.81e-22	107	1550	0.073	0.062	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
20	Q80TS3	1.90e-22	107	1537	0.075	0.064	AGRL3_MOUSE Adhesion G protein-coupled receptor L3 OS=Mus musculus OX=10090 GN=Adgrl3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00002 7tm_2	1.3e-09	49.3	7 transmembrane receptor (Secretin family)
2	PF01825 GPS	0.00088	31.2	GPCR proteolysis site, GPS, motif
3	PF02793 HRM	1.9	20.2	Hormone receptor domain
4	PF07679 I-set	0.01	27.2	Immunoglobulin I-set domain
5	PF00047 ig	15	17.1	Immunoglobulin domain
6	PF13895 Ig_2	0.11	24.1	Immunoglobulin domain
7	PF00560 LRR_1	27	16.6	Leucine Rich Repeat
8	PF12799 LRR_4	1.6e-05	36.4	Leucine Rich repeats (2 copies)
9	PF13306 LRR_5	0.00047	31.6	BspA type Leucine rich repeat region (6 copies)
10	PF13855 LRR_8	1.8e-22	90.1	Leucine rich repeat
11	PF14580 LRR_9	44	15.1	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334952

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341021	0.785	Nanos homolog 2
2	9606.ENSP00000332773	0.756	Immunoglobulin superfamily DCC subclass member 3
3	9606.ENSP00000404438	0.756	Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 1
4	9606.ENSP00000305906	0.746	Undifferentiated embryonic cell transcription factor 1
5	9606.ENSP00000423881	0.741	PACRG-like protein
6	9606.ENSP00000347591	0.716	GDNF family receptor alpha-1
7	9606.ENSP00000261769	0.648	Cadherin-1
8	9606.ENSP00000348132	0.641	Serine/threonine kinase 31
9	9606.ENSP00000338157	0.630	Zinc finger and BTB domain-containing protein 16
10	9606.ENSP00000381382	0.609	Transcription factor 4
11	9606.ENSP00000386896	0.607	Integrin alpha-6
12	9606.ENSP00000250863	0.601	Deleted in azoospermia-like
13	9606.ENSP00000342981	0.599	Adhesion G-protein coupled receptor G5
14	9606.ENSP00000296862	0.598	Adhesion G-protein coupled receptor F2
15	9606.ENSP00000424838	0.584	Probable ATP-dependent RNA helicase DDX4
16	9606.ENSP00000304945	0.568	Roundabout homolog 4
17	9606.ENSP00000353379	0.566	Melanoma-associated antigen 4
18	9606.ENSP00000332900	0.565	Adhesion G protein-coupled receptor G3
19	9606.ENSP00000420321	0.563	Roundabout homolog 1
20	9606.ENSP00000417335	0.556	Roundabout homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004930	1.000	G protein-coupled receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.995	signal transduction
GO:0007186	0.960	G protein-coupled receptor signaling pathway
GO:0032501	0.534	multicellular organismal process
GO:0032502	0.524	developmental process
GO:0048856	0.474	anatomical structure development
GO:0007275	0.382	multicellular organism development
GO:0048518	0.345	positive regulation of biological process
GO:0048522	0.338	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005886	0.979	plasma membrane
GO:0005622	0.613	intracellular anatomical structure
GO:0043226	0.590	organelle
GO:0043231	0.573	intracellular membrane-bounded organelle
GO:0005737	0.355	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]