StarFunc result for job id Q8IWN7

User Input

>input (2400 residues)
MNSTPRNAQAPSHRECFLPSVARTPSVTKVTPAKKITFLKRGDPRFAGVRLAVHQRAFKT
FSALMDELSQRVPLSFGVRSVTTPRGLHSLSALEQLEDGGCYLCSDKKPPKTPSGPGRPQ
ERNPTAQQLRDVEGQREAPGTSSSRKSLKTPRRILLIKNMDPRLQQTVVLSHRNTRNLAA
FLGKASDLLRFPVKQLYTTSGKKVDSLQALLHSPSVLVCAGHEAFRTPAMKNARRSEAET
LSGLTSRNKNGSWGPKTKPSVIHSRSPPGSTPRLPERPGPSNPPVGPAPGRHPQDTPAQS
GPLVAGDDMKKKVRMNEDGSLSVEMKVRFHLVGEDTLLWSRRMGRASALTAASGEDPVLG
EVDPLCCVWEGYPWGFSEPGVWGPRPCRVGCREVFGRGGQPGPKYEIWTNPLHASQGERV
AARKRWGLAQHVRCSGLWGHGTAGRERCSQDSASPASSTGLPEGSEPESSCCPRTPEDGV
DSASPSAQIGAERKAGGSLGEDPGLCIDGAGLGGPEQGGRLTPRARSEEGASSDSSASTG
SHEGSSEWGGRPQGCPGKARAETSQQEASEGGDPASPALSLSSLRSDDLQAETQGQGTEQ
ATGAAVTREPLVLGLSCSWDSEGASSTPSTCTSSQQGQRRHRSRASAMSSPSSPGLGRVA
PRGHPRHSHYRKDTHSPLDSSVTKQVPRPPERRRACQDGSVPRYSGSSSSTRTQASGNLR
PPSSGSLPSQDLLGTSSATVTPAVHSDFVSGVSPHNAPSAGWAGDAGSRTCSPAPIPPHT
SDSCSKSGAASLGEEARDTPQPSSPLVLQVGRPEQGAVGPHRSHCCSQPGTQPAQEAQRG
PSPEASWLCGRYCPTPPRGRPCPQRRSSSCGSTGSSHQSTARGPGGSPQEGTRQPGPTPS
PGPNSGASRRSSASQGAGSRGLSEEKTLRSGGGPQGQEEASGVSPSSLPRSSPEAVVREW
LDNIPEEPILMTYELADETTGAAGGGLRGPEVDPGDDHSLEGLGEPAQAGQQSLEGDPGQ
DPEPEGALLGSSDTGPQSGEGVPQGAAPEGVSEAPAEAGADREAPAGCRVSLRALPGRVS
ASTQIMRALMGSKQGRPSSVPEVSRPMARRLSCSAGALITCLASLQLFEEDLGSPASKVR
FKDSPRYQELLSISKDLWPGCDVGEDQLDSGLWELTWSQALPDLGSHAMTENFTPTSSSG
VDISSGSGGSGESSVPCAMDGTLVTQGTELPLKTSNQRPDSRTYESPGDLENQQQCCFPT
FLNARACACATNEDEAERDSEEQRASSNLEQLAENTVQEEVQLEETKEGTEGEGLQEEAV
QLEETKTEEGLQEEGVQLEETKETEGEGQQEEEAQLEEIEETGGEGLQEEGVQLEEVKEG
PEGGLQGEALEEGLKEEGLPEEGSVHGQELSEASSPDGKGSQEDDPVQEEEAGRASASAE
PCPAEGTEEPTEPPSHLSETDPSASERQSGSQLEPGLEKPPGATMMGQEHTQAQPTQGAA
ERSSSVACSAALDCDPIWVSVLLKKTEKAFLAHLASAVAELRARWGLQDNDLLDQMAAEL
QQDVAQRLQDSTKRELQKLQGRAGRMVLEPPREALTGELLLQTQQRRHRLRGLRNLSAFS
ERTLGLGPLSFTLEDEPALSTALGSQLGEEAEGEEFCPCEACVRKKVSPMSPKATMGATR
GPIKEAFDLQQILQRKRGEHTDGEAAEVAPGKTHTDPTSTRTVQGAEGGLGPGLSQGPGV
DEGEDGEGSQRLNRDKDPKLGEAEGDAMAQEREGKTHNSETSAGSELGEAEQEGEGISER
GETGGQGSGHEDNLQGEAAAGGDQDPGQSDGAEGIEAPEAEGEAQPESEGVEAPEAEGDA
QEAEGEAQPESEDVEAPEAEGEAQPESEDVETPEAEWEVQPESEGAEAPEAEKEAQPETE
SVEALETEGEDEPESEGAEAQEAEEAAQEAEGQTQPESEVIESQEAEEEAQPESEDVEAL
EVEVETQEAEGEAQPESEDVEAPEAEGEMQEAEEEAQPESDGVEAQPKSEGEEAQEVEGE
TQKTEGDAQPESDGVEAPEAEEEAQEAEGEVQEAEGEAHPESEDVDAQEAEGEAQPESEG
VEAPEAEGEAQKAEGIEAPETEGEAQPESEGIEAPEAEGEAQPESEGVEAQDAEGEAQPE
SEGIEAQEAEEEAQPELEGVEAPEAEGEAQPESEGIEAPEAEGEAQPELEGVEAPEAEEE
AQPEPEGVETPEAEGEAQPESEGETQGEKKGSPQVSLGDGQSEEASESSSPVPEDRPTPP
PSPGGDTPHQRPGSQTGPSSSRASSWGNCWQKDSENDHVLGDTRSPDAKSTGTPHAERKA
TRMYPESSTSEQEEAPLGSRTPEQGASEGYDLQEDQALGSLAPTEAVGRADGFGQDDLDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CGM2	0.091	0.109	0.000	1859	0.355	0.458	Q8CGM2.pdb.gz	RP1L1_MOUSE Retinitis pigmentosa 1-like 1 protein OS=Mus musculus OX=10090 GN=Rp1l1 PE=1 SV=1
2	AFDB:Q8IWN7	0.999	0.999	0.000	2400	1.000	1.000	Q8IWN7.pdb.gz	RP1L1_HUMAN Retinitis pigmentosa 1-like 1 protein OS=Homo sapiens OX=9606 GN=RP1L1 PE=1 SV=5
3	AFDB:E7F630	0.079	0.079	3.253E-39	2394	0.205	0.205	E7F630.pdb.gz
4	AFDB:P56716	0.059	0.064	5.091E-28	2095	0.152	0.175	P56716.pdb.gz	RP1_MOUSE Oxygen-regulated protein 1 OS=Mus musculus OX=10090 GN=Rp1 PE=1 SV=2
5	AFDB:P56715	0.051	0.055	1.180E-25	2156	0.149	0.166	P56715.pdb.gz	RP1_HUMAN Oxygen-regulated protein 1 OS=Homo sapiens OX=9606 GN=RP1 PE=1 SV=1
6	AFDB:D3ZUI5	0.041	0.064	4.223E-8	1133	0.077	0.164	D3ZUI5.pdb.gz	COBL_RAT Protein cordon-bleu OS=Rattus norvegicus OX=10116 GN=Cobl PE=1 SV=1
7	AFDB:O75128	0.043	0.064	7.280E-8	1261	0.079	0.151	O75128.pdb.gz	COBL_HUMAN Protein cordon-bleu OS=Homo sapiens OX=9606 GN=COBL PE=1 SV=2
8	AFDB:E7F568	0.037	0.057	2.756E-7	1343	0.082	0.147	E7F568.pdb.gz	COBL_DANRE Protein cordon-bleu OS=Danio rerio OX=7955 GN=cobl PE=1 SV=2
9	AFDB:Q53SF7	0.052	0.084	4.209E-7	1128	0.075	0.159	Q53SF7.pdb.gz	COBL1_HUMAN Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=3
10	PDB:4atuI	0.030	0.656	6.851E-7	106	0.011	0.245	4atuI.pdb.gz	Molecular Basis for Specific Regulation of Neuronal Kinesin- 3 Motors by Doublecortin Family Proteins.
11	AFDB:Q5NBX1	0.040	0.059	4.457E-6	1337	0.081	0.146	Q5NBX1.pdb.gz	COBL_MOUSE Protein cordon-bleu OS=Mus musculus OX=10090 GN=Cobl PE=1 SV=1
12	PDB:7rbsB	0.033	0.337	1.583E-3	157	0.012	0.178	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
13	PDB:1j0gA	0.031	0.603	1.029E-1	92	0.006	0.152	1j0gA.pdb.gz
14	PDB:5xqmA	0.027	0.510	1.162E-1	90	0.004	0.100	5xqmA.pdb.gz
15	PDB:5ia8A	0.028	0.580	1.311E-1	92	0.005	0.141	5ia8A.pdb.gz
16	PDB:3plvA	0.026	0.551	2.003E-1	80	0.003	0.100	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
17	PDB:1a5rA	0.027	0.408	3.059E-1	103	0.005	0.126	1a5rA.pdb.gz
18	PDB:1wz0A	0.029	0.448	3.059E-1	104	0.002	0.048	1wz0A.pdb.gz
19	PDB:2k1fA	0.027	0.469	3.059E-1	88	0.006	0.170	2k1fA.pdb.gz
20	PDB:5itdA	0.028	0.063	7.136E-1	995	0.012	0.028	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CGM2	0.0	921	1859	0.265	0.343	RP1L1_MOUSE Retinitis pigmentosa 1-like 1 protein OS=Mus musculus OX=10090 GN=Rp1l1 PE=1 SV=1
2	Q8IWN7	0.0	4693	2400	1.000	1.000	RP1L1_HUMAN Retinitis pigmentosa 1-like 1 protein OS=Homo sapiens OX=9606 GN=RP1L1 PE=1 SV=5
3	P56716	1.69e-46	187	2095	0.050	0.057	RP1_MOUSE Oxygen-regulated protein 1 OS=Mus musculus OX=10090 GN=Rp1 PE=1 SV=2
4	P56715	2.71e-41	171	2156	0.046	0.051	RP1_HUMAN Oxygen-regulated protein 1 OS=Homo sapiens OX=9606 GN=RP1 PE=1 SV=1
5	O74423	5.80e-16	86.7	702	0.030	0.104	ENT1_SCHPO Epsin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ent1 PE=1 SV=2
6	O15075	8.14e-15	83.2	740	0.026	0.084	DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens OX=9606 GN=DCLK1 PE=1 SV=2
7	Q9JLM8	1.02e-14	82.8	756	0.024	0.075	DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus OX=10090 GN=Dclk1 PE=1 SV=1
8	A2A121	1.78e-14	82.0	810	0.025	0.075	A2A121_DANRE Doublecortin like protein kinase_1 OS=Danio rerio OX=7955 GN=cb572 PE=1 SV=1
9	A2A122	1.99e-14	82.0	791	0.025	0.077	A2A122_DANRE Doublecortin like protein kinase_2 OS=Danio rerio OX=7955 GN=cb572 PE=1 SV=1
10	A2A124	2.58e-14	81.3	722	0.030	0.098	A2A124_DANRE Doublecortin like protein kinase_4 OS=Danio rerio OX=7955 GN=cb572 PE=1 SV=1
11	A2A123	2.66e-14	81.3	725	0.031	0.102	A2A123_DANRE Dclk2 protein OS=Danio rerio OX=7955 GN=dclk2 PE=1 SV=1
12	Q95QC4	9.93e-13	76.3	802	0.023	0.070	DCLK_CAEEL Serine/threonine-protein kinase zyg-8 OS=Caenorhabditis elegans OX=6239 GN=zyg-8 PE=1 SV=1
13	Q5DU00	1.74e-12	74.7	475	0.024	0.120	DCDC2_MOUSE Doublecortin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Dcdc2 PE=1 SV=2
14	O43602	4.75e-12	72.4	365	0.035	0.230	DCX_HUMAN Neuronal migration protein doublecortin OS=Homo sapiens OX=9606 GN=DCX PE=1 SV=4
15	Q9ESI7	5.14e-12	72.4	365	0.035	0.230	DCX_RAT Neuronal migration protein doublecortin OS=Rattus norvegicus OX=10116 GN=Dcx PE=1 SV=2
16	D3ZR10	7.98e-12	72.8	475	0.023	0.118	DCDC2_RAT Doublecortin domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Dcdc2 PE=1 SV=1
17	Q8N568	1.13e-11	72.8	766	0.023	0.072	DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens OX=9606 GN=DCLK2 PE=1 SV=4
18	O88809	2.49e-11	70.5	366	0.033	0.216	DCX_MOUSE Neuronal migration protein doublecortin OS=Mus musculus OX=10090 GN=Dcx PE=1 SV=1
19	Q9UHG0	2.83e-11	70.9	476	0.023	0.118	DCDC2_HUMAN Doublecortin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=DCDC2 PE=1 SV=2
20	G5E9L9	4.41e-11	70.9	695	0.023	0.081	G5E9L9_HUMAN Doublecortin and CaM kinase-like 2, isoform CRA_c OS=Homo sapiens OX=9606 GN=DCLK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03607 DCX	9.9e-25	97.7	Doublecortin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371923

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313921	0.909	Mitochondrial peptide methionine sulfoxide reductase
2	9606.ENSP00000451145	0.902	Uncharacterized protein
3	9606.ENSP00000301921	0.815	Transcription factor SOX-7
4	9606.ENSP00000367766	0.688	X-linked retinitis pigmentosa GTPase regulator
5	9606.ENSP00000394484	0.684	Serine/threonine-protein kinase DCLK3
6	9606.ENSP00000332809	0.679	Uncharacterized protein C2orf71
7	9606.ENSP00000229771	0.643	Tubby-related protein 1
8	9606.ENSP00000274710	0.633	Pleckstrin and Sec7 domain containing 2
9	9606.ENSP00000403465	0.604	Coiled-coil and C2 domain-containing protein 2A
10	9606.ENSP00000359245	0.601	Retinal-specific ATP-binding cassette transporter
11	9606.ENSP00000424243	0.596	Protein eyes shut homolog
12	9606.ENSP00000230381	0.581	Peripherin-2
13	9606.ENSP00000385158	0.581	Protein FAM161A
14	9606.ENSP00000385995	0.575	Thyroid adenoma-associated protein
15	9606.ENSP00000233838	0.571	Vitamin K-dependent gamma-carboxylase
16	9606.ENSP00000330572	0.561	C-Jun-amino-terminal kinase-interacting protein 2
17	9606.ENSP00000478767	0.557	Neurabin-2
18	9606.ENSP00000316605	0.549	Cyclic nucleotide-gated cation channel beta-3
19	9606.ENSP00000324960	0.549	Calcium-binding protein 4
20	9606.ENSP00000342144	0.548	Limbin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.991	multicellular organismal process
GO:0042592	0.967	homeostatic process
GO:0001895	0.955	retina homeostasis
GO:0045494	0.952	photoreceptor cell maintenance
GO:0009987	0.552	cellular process
GO:0050789	0.499	regulation of biological process
GO:0050794	0.494	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005929	0.998	cilium
GO:0005856	0.997	cytoskeleton
GO:0043005	0.975	neuron projection
GO:0097730	0.955	non-motile cilium
GO:0001750	0.869	photoreceptor outer segment
GO:0043231	0.864	intracellular membrane-bounded organelle
GO:0016020	0.854	membrane
GO:0035869	0.842	ciliary transition zone
GO:0099568	0.840	cytoplasmic region
GO:0032838	0.828	plasma membrane bounded cell projection cytoplasm
GO:0071944	0.736	cell periphery
GO:0032391	0.719	photoreceptor connecting cilium
GO:0005634	0.716	nucleus
GO:0097014	0.696	ciliary plasm
GO:0005930	0.590	axoneme

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]