StarFunc result for job id Q8IWR0

User Input

>input (971 residues)
MSNVSEERRKRQQNIKEGLQFIQSPLSYPGTQEQYAVYLRALVRNLFNEGNDVYREHDWN
NSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCNIVLSLNA
SNCKALYRKSKALSDLGRYKKAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYVR
AELSLKSVPGDGATKALNHSVEDIEPDLLTPRQEAVPVVSLPAPSFSHEVGSELASVPVM
PLTSILPLQVEESALPSAVLANGGKMPFTMPEAFLDDGDMVLGDELDDLLDSAPETNETV
MPSALVRGPLQTASVSPSMPFSASLLGTLPIGARYAPPPSFSEFYPPLTSSLEDFCSSLN
SFSMSESKRDLSTSTSREGTPLNNSNSSLLLMNGPGSLFASENFLGISSQPRNDFGNFFG
SAVTKPSSSVTPRHPLEGTHELRQACQICFVKSGPKLMDFTYHANIDHKCKKDILIGRIK
NVEDKSWKKIRPRPTKTNYEGPYYICKDVAAEEECRYSGHCTFAYCQEEIDVWTLERKGA
FSREAFFGGNGKINLTVFKLLQEHLGEFIFLCEKCFDHKPRMISKRNKDNSTACSHPVTK
HEFEDNKCLVHILRETTVKYSKIRSFHGQCQLDLCRHEVRYGCLREDECFYAHSLVELKV
WIMQNETGISHDAIAQESKRYWQNLEANVPGAQVLGNQIMPGFLNMKIKFVCAQCLRNGQ
VIEPDKNRKYCSAKARHSWTKDRRAMRVMSIERKKWMNIRPLPTKKQMPLQFDLCNHIAS
GKKCQYVGNCSFAHSPEEREVWTYMKENGIQDMEQFYELWLKSQKNEKSEDIASQSNKEN
GKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFP
TGYFSICDRYMNGTCPEGNSCKFAHGNAELHEWEERRDALKMKLNKARKDHLIGPNDNDF
GKYSFLFKDLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IWR0	1.000	1.000	0.000	971	1.000	1.000	Q8IWR0.pdb.gz	Z3H7A_HUMAN Zinc finger CCCH domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZC3H7A PE=1 SV=1
2	AFDB:Q9C0D5	0.121	0.065	2.390E-6	1861	0.081	0.042	Q9C0D5.pdb.gz	TANC1_HUMAN Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3
3	AFDB:Q0VGY8	0.124	0.066	4.491E-6	1856	0.071	0.037	Q0VGY8.pdb.gz	TANC1_MOUSE Protein TANC1 OS=Mus musculus OX=10090 GN=Tanc1 PE=1 SV=2
4	PDB:1ihgA	0.134	0.351	1.029E-5	364	0.031	0.082	1ihgA.pdb.gz
5	PDB:6n3qF	0.129	0.583	3.461E-5	190	0.031	0.158	6n3qF.pdb.gz
6	AFDB:Q9CSP9	0.117	0.147	6.793E-5	761	0.069	0.088	Q9CSP9.pdb.gz	TTC14_MOUSE Tetratricopeptide repeat protein 14 OS=Mus musculus OX=10090 GN=Ttc14 PE=1 SV=3
7	PDB:7kw7E	0.118	0.336	7.164E-5	327	0.035	0.104	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
8	AFDB:A2A690	0.125	0.063	8.248E-5	1994	0.063	0.031	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
9	PDB:7dhgC	0.123	0.251	3.383E-4	470	0.033	0.068	7dhgC.pdb.gz
10	PDB:7obeA	0.116	0.228	3.551E-4	480	0.020	0.040	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
11	PDB:4i2wA	0.119	0.128	4.526E-4	904	0.032	0.034	4i2wA.pdb.gz	The myosin chaperone UNC-45 is organized in tandem modules to support myofilament formation in C. elegans.
12	PDB:5jheA	0.131	0.321	4.751E-4	388	0.026	0.064	5jheA.pdb.gz
13	PDB:2y4uA	0.133	0.289	1.138E-3	424	0.024	0.054	2y4uA.pdb.gz
14	PDB:1wao1	0.118	0.234	1.254E-3	471	0.033	0.068	1wao1.pdb.gz	Molecular Basis for Tpr Domain-Mediated Regulation of Protein Phosphatase 5
15	PDB:7qe7K	0.131	0.234	1.450E-3	531	0.025	0.045	7qe7K.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
16	AFDB:F4HS99	0.118	0.066	2.988E-3	1797	0.063	0.034	F4HS99.pdb.gz	REC1_ARATH Protein REDUCED CHLOROPLAST COVERAGE 1 OS=Arabidopsis thaliana OX=3702 GN=REC1 PE=1 SV=1
17	AFDB:F4HZK4	0.103	0.067	3.136E-3	1608	0.080	0.049	F4HZK4.pdb.gz	REC3_ARATH Protein REDUCED CHLOROPLAST COVERAGE 3 OS=Arabidopsis thaliana OX=3702 GN=REC3 PE=3 SV=1
18	AFDB:P33981	0.106	0.119	3.997E-3	857	0.060	0.068	P33981.pdb.gz	TTK_HUMAN Dual specificity protein kinase TTK OS=Homo sapiens OX=9606 GN=TTK PE=1 SV=2
19	AFDB:F4JKH6	0.105	0.062	8.274E-3	1819	0.093	0.049	F4JKH6.pdb.gz	REC2_ARATH Protein REDUCED CHLOROPLAST COVERAGE 2 OS=Arabidopsis thaliana OX=3702 GN=REC2 PE=1 SV=1
20	AFDB:Q5ADP3	0.119	0.108	9.117E-3	1080	0.066	0.059	Q5ADP3.pdb.gz	Q5ADP3_CANAL Transcription regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN6 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IWR0	0.0	2038	971	1.000	1.000	Z3H7A_HUMAN Zinc finger CCCH domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZC3H7A PE=1 SV=1
2	Q9UGR2	0.0	879	977	0.475	0.472	Z3H7B_HUMAN Zinc finger CCCH domain-containing protein 7B OS=Homo sapiens OX=9606 GN=ZC3H7B PE=1 SV=2
3	E9QAM5	2.77e-12	73.9	2947	0.056	0.018	HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus OX=10090 GN=Helz2 PE=1 SV=1
4	Q567I0	1.22e-10	64.7	218	0.042	0.188	Q567I0_DANRE Unc-45 homolog A (C. elegans) OS=Danio rerio OX=7955 GN=zgc:112031 PE=1 SV=1
5	O13754	1.18e-08	60.5	358	0.042	0.115	CNS1_SCHPO Hsp70/Hsp90 co-chaperone cns1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cns1 PE=3 SV=1
6	Q9H3U1	2.78e-08	60.5	944	0.043	0.044	UN45A_HUMAN Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A PE=1 SV=1
7	A0A1W2PNX8	3.41e-08	60.1	1084	0.037	0.033	A0A1W2PNX8_HUMAN Unc-45 myosin chaperone A OS=Homo sapiens OX=9606 GN=UNC45A PE=1 SV=1
8	Q6PBY6	9.06e-08	58.5	578	0.041	0.069	Q6PBY6_DANRE Mitochondrial import receptor subunit TOM70 OS=Danio rerio OX=7955 GN=TOM70 PE=1 SV=1
9	Q8CGY6	2.30e-07	57.4	931	0.039	0.041	UN45B_MOUSE Protein unc-45 homolog B OS=Mus musculus OX=10090 GN=Unc45b PE=1 SV=1
10	Q8IWX7	2.40e-07	57.4	931	0.035	0.037	UN45B_HUMAN Protein unc-45 homolog B OS=Homo sapiens OX=9606 GN=UNC45B PE=1 SV=1
11	Q99KD5	2.96e-07	57.0	944	0.036	0.037	UN45A_MOUSE Protein unc-45 homolog A OS=Mus musculus OX=10090 GN=Unc45a PE=1 SV=2
12	B7ZWR6	8.51e-07	55.1	554	0.034	0.060	OEP61_ARATH Outer envelope protein 61 OS=Arabidopsis thaliana OX=3702 GN=OEP61 PE=1 SV=1
13	B6GVA2	1.43e-06	53.1	261	0.034	0.126	B6GVA2_SOLLC Tetratricopeptide repeat protein OS=Solanum lycopersicum OX=4081 GN=int106 PE=1 SV=1
14	Q9LDC0	1.58e-06	53.9	365	0.035	0.093	FKB42_ARATH Peptidyl-prolyl cis-trans isomerase FKBP42 OS=Arabidopsis thaliana OX=3702 GN=FKBP42 PE=1 SV=1
15	Q15785	2.04e-06	53.1	309	0.035	0.110	TOM34_HUMAN Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2
16	P33313	2.20e-06	53.5	385	0.034	0.086	CNS1_YEAST Hsp70/Hsp90 co-chaperone CNS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CNS1 PE=1 SV=1
17	Q9BYK8	2.20e-06	54.3	2649	0.031	0.011	HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens OX=9606 GN=HELZ2 PE=1 SV=6
18	Q9MUK5	2.24e-06	53.9	593	0.030	0.049	TOC64_PEA Translocon at the outer membrane of chloroplasts 64 OS=Pisum sativum OX=3888 GN=TOC64 PE=1 SV=1
19	Q9VJD4	2.48e-06	53.1	331	0.040	0.118	Q9VJD4_DROME LD24721p OS=Drosophila melanogaster OX=7227 GN=Sgt PE=1 SV=1
20	E5KN55	3.60e-06	52.8	370	0.034	0.089	E5KN55_HUMAN Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00515 TPR_1	3.1e+02	12.6	Tetratricopeptide repeat
2	PF07719 TPR_2	14	17.2	Tetratricopeptide repeat
3	PF12171 zf-C2H2_jaz	2	20.0	Zinc-finger double-stranded RNA-binding
4	PF00642 zf-CCCH	0.00065	30.8	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
5	PF18044 zf-CCCH_4	13	16.9	CCCH-type zinc finger
6	PF12874 zf-met	73	15.2	Zinc-finger of C2H2 type
7	PF18345 zf_CCCH_4	0.58	21.5	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379773

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342680	0.654	Uncharacterized protein CXorf67
2	9606.ENSP00000255977	0.618	E3 ubiquitin-protein ligase makorin-1
3	9606.ENSP00000362166	0.610	Chromatin modification-related protein MEAF6
4	9606.ENSP00000371126	0.595	NUT family member 2A
5	9606.ENSP00000367705	0.582	BCL-6 corepressor
6	9606.ENSP00000468304	0.557	MBT domain-containing protein 1
7	9606.ENSP00000330509	0.550	Dexamethasone-induced protein
8	9606.ENSP00000362774	0.546	Roquin-2
9	9606.ENSP00000253048	0.542	Zinc finger CCCH domain-containing protein 4
10	9606.ENSP00000338788	0.531	Zinc finger CCCH domain-containing protein 15
11	9606.ENSP00000483408	0.530	RNA-binding protein 26
12	9606.ENSP00000275766	0.528	Zinc finger CCCH-type containing, antiviral 1 like
13	9606.ENSP00000262394	0.522	WD repeat and SOCS box-containing protein 1
14	9606.ENSP00000363640	0.518	PHD finger protein 1
15	9606.ENSP00000217169	0.507	Baculoviral IAP repeat-containing protein 7
16	9606.ENSP00000364519	0.505	Transcription factor Dp-1
17	9606.ENSP00000170447	0.500	Probable E3 ubiquitin-protein ligase makorin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035198	0.999	miRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0009987	0.997	cellular process
GO:0071704	0.987	organic substance metabolic process
GO:0010605	0.986	negative regulation of macromolecule metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0044238	0.981	primary metabolic process
GO:0043170	0.980	macromolecule metabolic process
GO:0044237	0.979	cellular metabolic process
GO:0031047	0.975	RNA-mediated gene silencing
GO:0010608	0.972	post-transcriptional regulation of gene expression
GO:0090304	0.972	nucleic acid metabolic process
GO:0010467	0.968	gene expression
GO:0016070	0.946	RNA metabolic process
GO:0034660	0.933	ncRNA metabolic process
GO:0006396	0.892	RNA processing
GO:0070918	0.857	regulatory ncRNA processing
GO:0035196	0.845	miRNA processing
GO:0050794	0.704	regulation of cellular process
GO:0048523	0.352	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0005829	0.993	cytosol
GO:0005634	0.980	nucleus
GO:0043228	0.913	non-membrane-bounded organelle
GO:0043232	0.901	intracellular non-membrane-bounded organelle
GO:0031974	0.892	membrane-enclosed lumen
GO:0070013	0.881	intracellular organelle lumen
GO:0031981	0.772	nuclear lumen
GO:0005654	0.607	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]