StarFunc result for job id Q8IWT1

User Input

>input (228 residues)
MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFG
FEDLHFRWTYNSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRD
LEFSDTGKYTCHVKNPKENNLQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILI
LLIKKLIIFILKKTREKKKECLVSSSGNDNTENGLPGSKAEEKPPSKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IWT1	1.000	1.000	7.406E-41	228	1.000	1.000	Q8IWT1.pdb.gz	SCN4B_HUMAN Sodium channel subunit beta-4 OS=Homo sapiens OX=9606 GN=SCN4B PE=1 SV=1
2	AFDB:Q7M729	0.754	0.754	6.108E-35	228	0.794	0.794	Q7M729.pdb.gz	SCN4B_MOUSE Sodium channel subunit beta-4 OS=Mus musculus OX=10090 GN=Scn4b PE=1 SV=1
3	AFDB:O60939	0.589	0.619	5.629E-15	215	0.259	0.274	O60939.pdb.gz	SCN2B_HUMAN Sodium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=SCN2B PE=1 SV=1
4	AFDB:P06907	0.506	0.468	1.538E-13	248	0.237	0.218	P06907.pdb.gz	MYP0_RAT Myelin protein P0 OS=Rattus norvegicus OX=10116 GN=Mpz PE=1 SV=1
5	AFDB:A0A2R8QN30	0.485	0.485	3.565E-13	228	0.202	0.202	A0A2R8QN30.pdb.gz	A0A2R8QN30_DANRE Myelin protein P0 isoform X1 OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
6	AFDB:O60487	0.489	0.517	5.905E-13	215	0.215	0.228	O60487.pdb.gz	MPZL2_HUMAN Myelin protein zero-like protein 2 OS=Homo sapiens OX=9606 GN=MPZL2 PE=1 SV=1
7	AFDB:O95297	0.485	0.417	1.620E-12	269	0.254	0.216	O95297.pdb.gz	MPZL1_HUMAN Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1
8	AFDB:Q6UWV2	0.476	0.463	4.700E-12	235	0.211	0.204	Q6UWV2.pdb.gz	MPZL3_HUMAN Myelin protein zero-like protein 3 OS=Homo sapiens OX=9606 GN=MPZL3 PE=1 SV=1
9	AFDB:A4JYI5	0.481	0.462	5.560E-12	238	0.193	0.185	A4JYI5.pdb.gz
10	AFDB:O70255	0.480	0.506	6.958E-12	215	0.232	0.247	O70255.pdb.gz	MPZL2_MOUSE Myelin protein zero-like protein 2 OS=Mus musculus OX=10090 GN=Mpzl2 PE=1 SV=1
11	PDB:3oaiA	0.439	0.214	4.959E-10	488	0.132	0.061	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
12	PDB:5ir3A	0.398	0.758	8.581E-7	111	0.096	0.198	5ir3A.pdb.gz
13	PDB:1hzhH	0.413	0.222	2.946E-6	457	0.110	0.055	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
14	PDB:3zhlA	0.399	0.689	3.686E-6	121	0.105	0.198	3zhlA.pdb.gz
15	PDB:1aqkL	0.395	0.416	4.879E-6	216	0.088	0.093	1aqkL.pdb.gz
16	PDB:6sm1A	0.352	0.686	7.223E-6	111	0.088	0.180	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.
17	PDB:1ezvX	0.388	0.646	8.546E-6	127	0.088	0.157	1ezvX.pdb.gz	Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
18	PDB:1ngwH	0.409	0.429	8.546E-6	216	0.092	0.097	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
19	PDB:1cd0A	0.401	0.768	1.069E-5	111	0.088	0.180	1cd0A.pdb.gz
20	PDB:8e4cC	0.323	0.494	1.338E-5	142	0.136	0.218	8e4cC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IWT1	2.78e-166	459	228	1.000	1.000	SCN4B_HUMAN Sodium channel subunit beta-4 OS=Homo sapiens OX=9606 GN=SCN4B PE=1 SV=1
2	Q7M730	2.50e-124	353	228	0.803	0.803	SCN4B_RAT Sodium channel subunit beta-4 OS=Rattus norvegicus OX=10116 GN=Scn4b PE=1 SV=1
3	Q7M729	8.49e-122	347	228	0.794	0.794	SCN4B_MOUSE Sodium channel subunit beta-4 OS=Mus musculus OX=10090 GN=Scn4b PE=1 SV=1
4	O60939	1.46e-19	85.5	215	0.259	0.274	SCN2B_HUMAN Sodium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=SCN2B PE=1 SV=1
5	P54900	1.81e-19	85.1	215	0.259	0.274	SCN2B_RAT Sodium channel subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Scn2b PE=1 SV=1
6	Q56A07	1.71e-18	82.4	215	0.250	0.265	SCN2B_MOUSE Sodium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Scn2b PE=1 SV=1
7	E7F7T2	5.38e-08	54.3	264	0.237	0.205	E7F7T2_DANRE Myelin protein zero-like 1 like OS=Danio rerio OX=7955 GN=zgc:110608 PE=1 SV=1
8	O70255	1.69e-07	52.4	215	0.162	0.172	MPZL2_MOUSE Myelin protein zero-like protein 2 OS=Mus musculus OX=10090 GN=Mpzl2 PE=1 SV=1
9	P06907	2.33e-07	52.4	248	0.184	0.169	MYP0_RAT Myelin protein P0 OS=Rattus norvegicus OX=10116 GN=Mpz PE=1 SV=1
10	P27573	2.51e-07	52.0	248	0.184	0.169	MYP0_MOUSE Myelin protein P0 OS=Mus musculus OX=10090 GN=Mpz PE=1 SV=1
11	O60487	1.80e-06	49.3	215	0.180	0.191	MPZL2_HUMAN Myelin protein zero-like protein 2 OS=Homo sapiens OX=9606 GN=MPZL2 PE=1 SV=1
12	P25189	2.42e-06	49.3	248	0.154	0.141	MYP0_HUMAN Myelin protein P0 OS=Homo sapiens OX=9606 GN=MPZ PE=1 SV=1
13	P0C673	4.28e-06	48.9	428	0.175	0.093	IGS11_MOUSE Immunoglobulin superfamily member 11 OS=Mus musculus OX=10090 GN=Igsf11 PE=1 SV=1
14	A0A0R4IS04	1.82e-05	46.6	212	0.171	0.184	A0A0R4IS04_DANRE Myelin protein P0 isoform X2 OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
15	Q8JFG6	2.15e-05	46.2	203	0.171	0.192	Q8JFG6_DANRE Myelin protein P0 precursor OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
16	A0A2R8QN30	2.62e-05	46.2	228	0.167	0.167	A0A2R8QN30_DANRE Myelin protein P0 isoform X1 OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
17	A0A1C9HIH9	2.11e-04	43.9	475	0.228	0.109	A0A1C9HIH9_HUMAN Erythroblast membrane-associated protein OS=Homo sapiens OX=9606 GN=ERMAP PE=3 SV=1
18	Q96PL5	2.11e-04	43.9	475	0.228	0.109	ERMAP_HUMAN Erythroid membrane-associated protein OS=Homo sapiens OX=9606 GN=ERMAP PE=1 SV=1
19	O95297	4.69e-04	42.7	269	0.241	0.204	MPZL1_HUMAN Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1
20	Q3V3F6	0.001	41.6	237	0.219	0.211	MPZL3_MOUSE Myelin protein zero-like protein 3 OS=Mus musculus OX=10090 GN=Mpzl3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17359 DUF5385	2.1e+02	12.8	Family of unknown function (DUF5385)
2	PF01102 Glycophorin_A	14	17.3	Glycophorin A
3	PF07679 I-set	0.17	23.3	Immunoglobulin I-set domain
4	PF00047 ig	0.8	21.2	Immunoglobulin domain
5	PF13895 Ig_2	22	16.7	Immunoglobulin domain
6	PF13927 Ig_3	0.056	25.3	Immunoglobulin domain
7	PF01034 Syndecan	3.3e+02	12.6	Syndecan domain
8	PF15102 TMEM154	1.7e+02	13.5	TMEM154 protein family
9	PF06011 TRP	1.5e+02	12.6	Transient receptor potential (TRP) ion channel
10	PF07686 V-set	6e-07	41.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322460

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000396915	0.991	Sodium channel subunit beta-1
2	9606.ENSP00000396320	0.974	Sodium channel protein type 4 subunit alpha
3	9606.ENSP00000376523	0.973	Sodium channel subunit beta-3
4	9606.ENSP00000410257	0.965	Sodium channel protein type 5 subunit alpha
5	9606.ENSP00000364586	0.923	Sodium channel protein type 2 subunit alpha
6	9606.ENSP00000349588	0.916	Ankyrin-2
7	9606.ENSP00000345751	0.907	Amiloride-sensitive sodium channel subunit beta
8	9606.ENSP00000300061	0.905	Amiloride-sensitive sodium channel subunit gamma
9	9606.ENSP00000353292	0.902	Amiloride-sensitive sodium channel subunit alpha
10	9606.ENSP00000303540	0.901	Sodium channel protein type 1 subunit alpha
11	9606.ENSP00000346534	0.901	Sodium channel protein type 8 subunit alpha
12	9606.ENSP00000386796	0.894	Sodium channel protein type 7 subunit alpha
13	9606.ENSP00000390600	0.883	Sodium channel protein type 10 subunit alpha
14	9606.ENSP00000307599	0.832	Sodium channel protein type 11 subunit alpha
15	9606.ENSP00000283254	0.827	Sodium channel protein type 3 subunit alpha
16	9606.ENSP00000386306	0.825	Sodium channel protein type 9 subunit alpha
17	9606.ENSP00000278947	0.819	Sodium channel subunit beta-2
18	9606.ENSP00000217381	0.792	Alpha-1-syntrophin
19	9606.ENSP00000263373	0.784	Spectrin beta chain, non-erythrocytic 4
20	9606.ENSP00000344786	0.784	Neurofascin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044325	1.000	transmembrane transporter binding
GO:0005248	1.000	voltage-gated sodium channel activity
GO:0017080	0.997	sodium channel regulator activity
GO:0086006	0.410	voltage-gated sodium channel activity involved in cardiac muscle cell action potential

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0051179	0.994	localization
GO:0050789	0.987	regulation of biological process
GO:0032501	0.981	multicellular organismal process
GO:0098662	0.977	inorganic cation transmembrane transport
GO:0098655	0.977	monoatomic cation transmembrane transport
GO:0050794	0.964	regulation of cellular process
GO:0030001	0.959	metal ion transport
GO:0007154	0.937	cell communication
GO:0035725	0.935	sodium ion transmembrane transport
GO:0065008	0.929	regulation of biological quality
GO:0010959	0.911	regulation of metal ion transport
GO:0034765	0.909	regulation of monoatomic ion transmembrane transport
GO:0002027	0.906	regulation of heart rate
GO:1904062	0.901	regulation of monoatomic cation transmembrane transport
GO:0042391	0.900	regulation of membrane potential
GO:0023052	0.899	signaling
GO:0061337	0.885	cardiac conduction
GO:0030048	0.884	actin filament-based movement
GO:0086065	0.883	cell communication involved in cardiac conduction
GO:0006936	0.881	muscle contraction
GO:0001508	0.881	action potential
GO:0086001	0.873	cardiac muscle cell action potential
GO:0060048	0.858	cardiac muscle contraction
GO:0070252	0.853	actin-mediated cell contraction
GO:0032412	0.848	regulation of monoatomic ion transmembrane transporter activity
GO:0043270	0.843	positive regulation of monoatomic ion transport
GO:0007267	0.783	cell-cell signaling
GO:0051899	0.777	membrane depolarization
GO:0002028	0.734	regulation of sodium ion transport
GO:1902305	0.718	regulation of sodium ion transmembrane transport
GO:2000649	0.667	regulation of sodium ion transmembrane transporter activity
GO:0050896	0.469	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.997	protein-containing complex
GO:0034703	0.979	cation channel complex
GO:0098797	0.956	plasma membrane protein complex
GO:0001518	0.917	voltage-gated sodium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]