StarFunc result for job id Q8IWT3

User Input

>input (2517 residues)
MVGERHAGDLMVPLGPRLQAYPEELIRQRPGHDGHPEYLIRWSVLKCGEVGKVGVEEGKA
EHILMWLSAPEVYANCPGLLGERALSKGLQHEPAGVSGSFPRDPGGLDEVAMGEMEADVQ
ALVRRAARQLAESGTPSLTAAVLHTIHVLSAYASIGPLTGVFRETGALDLLMHMLCNPEP
QIRRSAGKMLQALAAHDAGSRAHVLLSLSQQDGIEQHMDFDSRYTLLELFAETTSSEEHC
MAFEGIHLPQIPGKLLFSLVKRYLCVTSLLDQLNSSPELGAGDQSSPCATREKSRGQREL
EFSMAVGNLISELVRSMGWARNLSEQGMSPPRPTRSIFQPYISGPSLLLPTIVTTPRRQG
WVFRQRSEFSSRSGYGEYVQQTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGIPPVQVFW
QSTGRTYWVHWHMLEILGPEEATEDKASAAVEKGAGATVLGTAFPSWDWNPMDGLYPLPY
LQPEPQKNERVGYLTQAEWWELLFFIKKLDLCEQQPIFQNLWKNLDETLGEKALGEISVS
VEMAESLLQVLSSRFEGSTLNDLLNSQIYTKYGLLSNEPSSSSTSRNHSCTPDPEEESKS
EASFSEEETESLKAKAEAPKTEAEPTKTRTETPMAQSDSQLFNQLLVTEGMTLPTEMKEA
ASEMARALRGPGPRSSLDQHVAAVVATVQISSLDTNLQLSGLSALSQAVEEVTERDHPLV
RPDRSLREKLVKMLVELLTNQVGEKMVVVQALRLLYLLMTKHEWRPLFAREGGIYAVLVC
MQEYKTSVLVQQAGLAALKMLAVASSSEIPTFVTGRDSIHSLFDAQMTREIFASIDSATR
PGSESLLLTVPAAVILMLNTEGCSSAARNGLLLLNLLLCNHHTLGDQIITQELRDTLFRH
SGIAPRTEPMPTTRTILMMLLNRYSEPPGSPERAALETPIIQGQDGSPELLIRSLVGGPS
AELLLDLERVLCREGSPGGAVRPLLKRLQQETQPFLLLLRTLDAPGPNKTLLLSVLRVIT
RLLDFPEAMVLPWHEVLEPCLNCLSGPSSDSEIVQELTCFLHRLASMHKDYAVVLCCLGA
KEILSKVLDKHSAQLLLGCELRDLVTECEKYAQLYSNLTSSILAGCIQMVLGQIEDHRRT
HQPINIPFFDVFLRHLCQGSSVEVKEDKCWEKVEVSSNPHRASKLTDHNPKTYWESNGST
GSHYITLHMHRGVLVRQLTLLVASEDSSYMPARVVVFGGDSTSCIGTELNTVNVMPSASR
VILLENLNRFWPIIQIRIKRCQQGGIDTRVRGVEVLGPKPTFWPLFREQLCRRTCLFYTI
RAQAWSRDIAEDHRRLLQLCPRLNRVLRHEQNFADRFLPDDEAAQALGKTCWEALVSPLV
QNITSPDAEGVSALGWLLDQYLEQRETSRNPLSRAASFASRVRRLCHLLVHVEPPPGPSP
EPSTRPFSKNSKGRDRSPAPSPVLPSSSLRNITQCWLSVVQEQVSRFLAAAWRAPDFVPR
YCKLYEHLQRAGSELFGPRAAFMLALRSGFSGALLQQSFLTAAHMSEQFARYIDQQIQGG
LIGGAPGVEMLGQLQRHLEPIMVLSGLELATTFEHFYQHYMADRLLSFGSSWLEGAVLEQ
IGLCFPNRLPQLMLQSLSTSEELQRQFHLFQLQRLDKLFLEQEDEEEKRLEEEEEEEEEE
EAEKELFIEDPSPAISILVLSPRCWPVSPLCYLYHPRKCLPTEFCDALDRFSSFYSQSQN
HPVLDMGPHRRLQWTWLGRAELQFGKQILHVSTVQMWLLLKFNQTEEVSVETLLKDSDLS
PELLLQALVPLTSGNGPLTLHEGQDFPHGGVLRLHEPGPQRSGEALWLIPPQAYLNVEKD
EGRTLEQKRNLLSCLLVRILKAHGEKGLHIDQLVCLVLEAWQKGPNPPGTLGHTVAGGVA
CTSTDVLSCILHLLGQGYVKRRDDRPQILMYAAPEPMGPCRGQADVPFCGSQSETSKPSP
EAVATLASLQLPAGRTMSPQEVEGLMKQTVRQVQETLNLEPDVAQHLLAHSHWGAEQLLQ
SYSEDPEPLLLAAGLCVHQAQAVPVRPDHCPVCVSPLGCDDDLPSLCCMHYCCKSCWNEY
LTTRIEQNLVLNCTCPIADCPAQPTGAFIRAIVSSPEVISKYEKALLRGYVESCSNLTWC
TNPQGCDRILCRQGLGCGTTCSKCGWASCFNCSFPEAHYPASCGHMSQWVDDGGYYDGMS
VEAQSKHLAKLISKRCPSCQAPIEKNEGCLHMTCAKCNHGFCWRCLKSWKPNHKDYYNCS
AMVSKAARQEKRFQDYNERCTFHHQAREFAVNLRNRVSAIHEVPPPRSFTFLNDACQGLE
QARKVLAYACVYSFYSQDAEYMDVVEQQTENLELHTNALQILLEETLLRCRDLASSLRLL
RADCLSTGMELLRRIQERLLAILQHSAQDFRVGLQSPSVEAWEAKGPNMPGSQPQASSGP
EAEEEEEDDEDDVPEWQQDEFDEELDNDSFSYDESENLDQETFFFGDEEEDEDEAYD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZEF4	0.445	0.631	0.000	1692	0.379	0.564	D3ZEF4.pdb.gz	CUL7_RAT Cullin-7 OS=Rattus norvegicus OX=10116 GN=Cul7 PE=1 SV=1
2	AFDB:Q8IWT3	1.000	1.000	0.000	2517	1.000	1.000	Q8IWT3.pdb.gz	CUL9_HUMAN Cullin-9 OS=Homo sapiens OX=9606 GN=CUL9 PE=1 SV=2
3	AFDB:Q8VE73	0.439	0.624	0.000	1689	0.368	0.548	Q8VE73.pdb.gz	CUL7_MOUSE Cullin-7 OS=Mus musculus OX=10090 GN=Cul7 PE=1 SV=2
4	PDB:7z8bC	0.351	0.673	6.188E-92	1224	0.324	0.667	7z8bC.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
5	AFDB:O01965	0.138	0.638	1.109E-18	494	0.049	0.249	O01965.pdb.gz	ARI11_CAEEL E3 ubiquitin-protein ligase ari-1.1 OS=Caenorhabditis elegans OX=6239 GN=ari-1.1 PE=1 SV=3
6	AFDB:O95376	0.129	0.565	1.980E-18	493	0.048	0.245	O95376.pdb.gz	ARI2_HUMAN E3 ubiquitin-protein ligase ARIH2 OS=Homo sapiens OX=9606 GN=ARIH2 PE=1 SV=1
7	AFDB:Q6T486	0.132	0.534	3.254E-18	520	0.050	0.242	Q6T486.pdb.gz	RBRA_DICDI Probable E3 ubiquitin-protein ligase rbrA OS=Dictyostelium discoideum OX=44689 GN=rbrA PE=3 SV=1
8	AFDB:Q94981	0.134	0.562	1.386E-17	503	0.048	0.239	Q94981.pdb.gz	ARI1_DROME E3 ubiquitin-protein ligase ariadne-1 OS=Drosophila melanogaster OX=7227 GN=ari-1 PE=1 SV=2
9	PDB:7od1A	0.126	0.629	3.114E-17	430	0.044	0.256	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
10	AFDB:Q8W468	0.136	0.536	5.004E-17	567	0.049	0.217	Q8W468.pdb.gz	ARI8_ARATH Probable E3 ubiquitin-protein ligase ARI8 OS=Arabidopsis thaliana OX=3702 GN=ARI8 PE=2 SV=1
11	PDB:7b5lH	0.142	0.706	6.838E-17	423	0.047	0.279	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
12	AFDB:Q9P3U4	0.138	0.606	1.883E-16	504	0.045	0.226	Q9P3U4.pdb.gz	HEL1_SCHPO E3 ubiquitin-protein ligase dbl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dbl4 PE=3 SV=1
13	PDB:5tteB	0.125	0.568	8.202E-16	442	0.046	0.260	5tteB.pdb.gz	Structural insights into the mechanism and E2 specificity of the RBR E3 ubiquitin ligase HHARI.
14	PDB:4kblA	0.117	0.601	1.591E-15	395	0.045	0.289	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
15	PDB:1ldjA	0.161	0.466	3.762E-13	725	0.044	0.152	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
16	PDB:7oniH	0.124	0.681	6.445E-13	380	0.035	0.229	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
17	PDB:6ttuC	0.170	0.485	9.910E-12	701	0.057	0.204	6ttuC.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
18	PDB:6v9iC	0.165	0.441	2.177E-11	730	0.052	0.181	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.
19	AFDB:Q3U487	0.061	0.161	4.674E-11	861	0.026	0.077	Q3U487.pdb.gz	HECD3_MOUSE E3 ubiquitin-protein ligase HECTD3 OS=Mus musculus OX=10090 GN=Hectd3 PE=1 SV=2
20	PDB:4a0kA	0.148	0.434	2.546E-9	719	0.043	0.152	4a0kA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZEF4	0.0	1270	1692	0.257	0.383	CUL7_RAT Cullin-7 OS=Rattus norvegicus OX=10116 GN=Cul7 PE=1 SV=1
2	E9PEZ1	0.0	5104	2489	0.989	1.000	E9PEZ1_HUMAN Cullin 9 OS=Homo sapiens OX=9606 GN=CUL9 PE=1 SV=1
3	Q14999	0.0	1303	1698	0.268	0.397	CUL7_HUMAN Cullin-7 OS=Homo sapiens OX=9606 GN=CUL7 PE=1 SV=2
4	Q8IWT3	0.0	5174	2517	1.000	1.000	CUL9_HUMAN Cullin-9 OS=Homo sapiens OX=9606 GN=CUL9 PE=1 SV=2
5	Q8VE73	0.0	1246	1689	0.250	0.373	CUL7_MOUSE Cullin-7 OS=Mus musculus OX=10090 GN=Cul7 PE=1 SV=2
6	Q6T486	2.45e-42	166	520	0.050	0.242	RBRA_DICDI Probable E3 ubiquitin-protein ligase rbrA OS=Dictyostelium discoideum OX=44689 GN=rbrA PE=3 SV=1
7	O95376	3.66e-39	156	493	0.043	0.219	ARI2_HUMAN E3 ubiquitin-protein ligase ARIH2 OS=Homo sapiens OX=9606 GN=ARIH2 PE=1 SV=1
8	Q6IBL8	3.66e-39	156	493	0.043	0.219	Q6IBL8_HUMAN RBR-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 GN=ARIH2 PE=2 SV=1
9	Q9Z1K6	7.42e-39	155	492	0.043	0.220	ARI2_MOUSE E3 ubiquitin-protein ligase ARIH2 OS=Mus musculus OX=10090 GN=Arih2 PE=1 SV=1
10	O01965	8.94e-38	152	494	0.045	0.231	ARI11_CAEEL E3 ubiquitin-protein ligase ari-1.1 OS=Caenorhabditis elegans OX=6239 GN=ari-1.1 PE=1 SV=3
11	Q9Z1K5	1.84e-35	146	555	0.046	0.211	ARI1_MOUSE E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus OX=10090 GN=Arih1 PE=1 SV=3
12	Q9Y4X5	2.87e-35	146	557	0.046	0.210	ARI1_HUMAN E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens OX=9606 GN=ARIH1 PE=1 SV=2
13	Q94981	1.93e-33	139	503	0.047	0.237	ARI1_DROME E3 ubiquitin-protein ligase ariadne-1 OS=Drosophila melanogaster OX=7227 GN=ari-1 PE=1 SV=2
14	Q8W468	3.17e-29	127	567	0.043	0.190	ARI8_ARATH Probable E3 ubiquitin-protein ligase ARI8 OS=Arabidopsis thaliana OX=3702 GN=ARI8 PE=2 SV=1
15	Q9P2G1	3.51e-29	130	1089	0.048	0.111	AKIB1_HUMAN Ankyrin repeat and IBR domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKIB1 PE=1 SV=3
16	Q9P3U4	9.11e-27	119	504	0.042	0.208	HEL1_SCHPO E3 ubiquitin-protein ligase dbl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dbl4 PE=3 SV=1
17	P36113	8.57e-25	114	551	0.042	0.191	HEL1_YEAST E3 ubiquitin-protein ligase HEL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HEL1 PE=1 SV=1
18	Q3U487	2.64e-20	101	861	0.021	0.062	HECD3_MOUSE E3 ubiquitin-protein ligase HECTD3 OS=Mus musculus OX=10090 GN=Hectd3 PE=1 SV=2
19	Q5T447	1.50e-19	98.6	861	0.021	0.060	HECD3_HUMAN E3 ubiquitin-protein ligase HECTD3 OS=Homo sapiens OX=9606 GN=HECTD3 PE=1 SV=1
20	Q5SSH7	2.23e-19	99.0	2924	0.021	0.018	ZZEF1_MOUSE Zinc finger ZZ-type and EF-hand domain-containing protein 1 OS=Mus musculus OX=10090 GN=Zzef1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03256 ANAPC10	8.9e-06	37.0	Anaphase-promoting complex, subunit 10 (APC10)
2	PF00514 Arm	3.3e+02	12.8	Armadillo/beta-catenin-like repeat
3	PF11515 Cul7	2.1e-29	113.0	Mouse development and cellular proliferation protein Cullin-7
4	PF00888 Cullin	1.3e-19	82.0	Cullin family
5	PF10557 Cullin_Nedd8	0.001	30.4	Cullin protein neddylation domain
6	PF01485 IBR	1e-08	46.4	IBR domain, a half RING-finger domain
7	PF12612 TFCD_C	4.6e+02	12.0	Tubulin folding cofactor D C terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252050

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.980	Cellular tumor antigen p53
2	9606.ENSP00000216225	0.975	E3 ubiquitin-protein ligase RBX1
3	9606.ENSP00000438788	0.949	Cullin-7
4	9606.ENSP00000250495	0.926	NEDD8
5	9606.ENSP00000388107	0.925	Ubiquitin-60S ribosomal protein L40
6	9606.ENSP00000301633	0.923	Baculoviral IAP repeat containing 5
7	9606.ENSP00000272317	0.919	Ubiquitin-40S ribosomal protein S27a
8	9606.ENSP00000441543	0.908	Polyubiquitin-C
9	9606.ENSP00000304697	0.906	Polyubiquitin-B
10	9606.ENSP00000303158	0.850	Coiled-coil domain-containing protein 8
11	9606.ENSP00000385636	0.846	Obscurin-like protein 1
12	9606.ENSP00000400906	0.779	Ubiquitin-conjugating enzyme E2L 3
13	9606.ENSP00000478501	0.773	Anaphase-promoting complex subunit 10
14	9606.ENSP00000253023	0.760	NEDD8-conjugating enzyme Ubc12
15	9606.ENSP00000318374	0.668	Leukocyte receptor cluster member 8
16	9606.ENSP00000423333	0.665	Ubiquitin carboxyl-terminal hydrolase 51
17	9606.ENSP00000288774	0.660	Peroxisome biogenesis factor 10
18	9606.ENSP00000231487	0.649	S-phase kinase-associated protein 1
19	9606.ENSP00000364589	0.645	Cullin-4A
20	9606.ENSP00000457168	0.638	KICSTOR complex protein SZT2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0019899	0.487	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050789	0.996	regulation of biological process
GO:0016567	0.994	protein ubiquitination
GO:0051783	0.993	regulation of nuclear division
GO:0007346	0.984	regulation of mitotic cell cycle
GO:0010564	0.974	regulation of cell cycle process
GO:0000226	0.968	microtubule cytoskeleton organization
GO:0007088	0.628	regulation of mitotic nuclear division
GO:0044237	0.509	cellular metabolic process
GO:0044260	0.424	cellular macromolecule metabolic process
GO:0048518	0.328	positive regulation of biological process
GO:0050896	0.300	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0032991	0.989	protein-containing complex
GO:0031461	0.950	cullin-RING ubiquitin ligase complex
GO:0043229	0.595	intracellular organelle
GO:0031981	0.522	nuclear lumen
GO:0005654	0.498	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]