StarFunc result for job id Q8IWU2

User Input

>input (1503 residues)
MPGPPALRRRLLLLLLVLLIAGSAGAAPLPQTGAGEAPPAAEVSSSFVILCVCSLIILIV
LIANCVSCCKDPEIDFKEFEDNFDDEIDFTPPAEDTPSVQSPAEVFTLSVPNISLPAPSQ
FQPSVEGLKSQVARHSLNYIQEIGNGWFGKVLLGEIYTGTSVARVIVKELKASANPKEQD
TFLKNGEPYYILQHPNILQCVGQCVEAIPYLLVFEFCDLGDLKAYLRSEQEHMRGDSQTM
LLQRMACEVAAGLAAMHKLHFLHSDLALRNCFLTSDLNVKVGDYGIGFSRYKEDYIETDD
KKVFPLRWTAPELVTSFQDRLLTADQTKYSNIWSLGVTLWELFDNAAQPYSNLSNLDVLN
QVIRERDTKLPKPQLEQPYSDRWYEVLQFCWLSPEKRPAAEDVHRLLTYLRLQSQRDSEV
DFEQQWNALKPNTNSRDSSNNAAFPILDHFARDRLGREMEEVLTVTETSQGLSFEYVWEA
AKHDHFDERSRGHLDEGLSYTSIFYPVEVFESSLSDPGPGKQDDSGQDVPLRVPGVVPVF
DAHNLSVGSDYYIQLEEKSGSNLELDYPPALLTTDMDNPERTGPELSQLTALRSVELEES
STDEDFFQSSTDPKDSSLPGDLHVTSGPESPFNNIFNDVDKSEDLPSHQKIFDLMELNGV
QADFKPATLSSSLDNPKESVITGHFEKEKPRKIFDSEPLCLSDNLMHQDNFDPLNVQELS
ENFLFLQEKNLLKGSLSSKEHINDLQTELKNAGFTEAMLETSCRNSLDTELQFAENKPGL
SLLQENVSTKGDDTDVMLTGDTLSTSLQSSPEVQVPPTSFETEETPRRVPPDSLPTQGET
QPTCLDVIVPEDCLHQDISPDAVTVPVEILSTDARTHSLDNRSQDSPGESEETLRLTESD
SVLADDILASRVSVGSSLPELGQELHNKPFSEDHHSHRRLEKNLEAVETLNQLNSKDAAK
EAGLVSALSSDSTSQDSLLEDSLSAPFPASEPSLETPDSLESVDVHEALLDSLGSHTPQK
LVPPDKPADSGYETENLESPEWTLHPAPEGTADSEPATTGDGGHSGLPPNPVIVISDAGD
GHRGTEVTPETFTAGSQGSYRDSAYFSDNDSEPEKRSEEVPGTSPSALVLVQEQPLPEPV
LPEQSPAAQDSCLEARKSQPDESCLSALHNSSDLELRATPEPAQTGVPQQVHPTEDEASS
PWSVLNAELSSGDDFETQDDRPCTLASTGTNTNELLAYTNSALDKSLSSHSEGPKLKEPD
IEGKYLGKLGVSGMLDLSEDGMDADEEDENSDDSDEDLRAFNLHSLSSESEDETEHPVPI
ILSNEDGRHLRSLLKPTAANAPDPLPEDWKKEKKAVTFFDDVTVYLFDQETPTKELGPCG
GEACGPDLSGPAPASGSPYLSRCINSESSTDEEGGGFEWDDDFSPDPFMSKTTSNLLSSK
PSLQTSKYFSPPPPARSTEQSWPHSAPYSRFSISPANIASFSLTHLTDSDIEQGGSSEDG
EKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZBH5	0.143	0.141	0.000	1531	0.728	0.715	D3ZBH5.pdb.gz	D3ZBH5_RAT Lemur tyrosine kinase 2 OS=Rattus norvegicus OX=10116 GN=Lmtk2 PE=1 SV=2
2	AFDB:Q8IWU2	0.999	0.999	0.000	1503	1.000	1.000	Q8IWU2.pdb.gz	LMTK2_HUMAN Serine/threonine-protein kinase LMTK2 OS=Homo sapiens OX=9606 GN=LMTK2 PE=1 SV=2
3	AFDB:Q80YE4	0.233	0.254	6.234E-60	1365	0.301	0.332	Q80YE4.pdb.gz	LMTK1_MOUSE Serine/threonine-protein kinase LMTK1 OS=Mus musculus OX=10090 GN=Aatk PE=1 SV=1
4	AFDB:Q6ZMQ8	0.234	0.255	3.327E-56	1374	0.316	0.346	Q6ZMQ8.pdb.gz	LMTK1_HUMAN Serine/threonine-protein kinase LMTK1 OS=Homo sapiens OX=9606 GN=AATK PE=1 SV=2
5	AFDB:Q96Q04	0.195	0.200	8.957E-49	1460	0.261	0.268	Q96Q04.pdb.gz	LMTK3_HUMAN Serine/threonine-protein kinase LMTK3 OS=Homo sapiens OX=9606 GN=LMTK3 PE=1 SV=2
6	AFDB:P00522	0.168	0.156	1.630E-21	1620	0.134	0.125	P00522.pdb.gz	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
7	AFDB:Q9I7F7	0.174	0.192	2.040E-21	1337	0.132	0.149	Q9I7F7.pdb.gz	ACKL_DROME Activated Cdc42 kinase-like OS=Drosophila melanogaster OX=7227 GN=Ack-like PE=1 SV=3
8	AFDB:A0A024R8E2	0.163	0.214	1.453E-20	1130	0.115	0.153	A0A024R8E2.pdb.gz
9	AFDB:F7BN18	0.161	0.212	5.279E-20	1128	0.118	0.157	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
10	PDB:2h8hA	0.153	0.475	8.778E-19	445	0.056	0.189	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
11	PDB:4fl2A	0.163	0.418	2.030E-17	555	0.050	0.135	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
12	AFDB:P80192	0.158	0.210	3.343E-17	1104	0.112	0.153	P80192.pdb.gz	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3
13	PDB:1k9aB	0.157	0.516	1.618E-16	441	0.053	0.179	1k9aB.pdb.gz
14	PDB:4k2rA	0.161	0.419	2.265E-16	551	0.047	0.127	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:6s73A	0.155	0.769	4.175E-14	269	0.042	0.234	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
16	PDB:6lk5A	0.152	0.751	5.527E-14	265	0.037	0.211	6lk5A.pdb.gz
17	PDB:4eomC	0.148	0.732	7.317E-14	276	0.039	0.214	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
18	PDB:4btfA	0.146	0.485	3.327E-13	413	0.035	0.128	4btfA.pdb.gz
19	PDB:8dksA	0.143	0.659	4.658E-13	283	0.039	0.208	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
20	PDB:3eqdA	0.151	0.627	5.211E-13	315	0.033	0.159	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZBH5	0.0	1679	1631	0.577	0.532	D3ZBH5_RAT Lemur tyrosine kinase 2 OS=Rattus norvegicus OX=10116 GN=Lmtk2 PE=1 SV=2
2	Q8IWU2	0.0	3053	1503	1.000	1.000	LMTK2_HUMAN Serine/threonine-protein kinase LMTK2 OS=Homo sapiens OX=9606 GN=LMTK2 PE=1 SV=2
3	Q6ZMQ8	5.90e-139	465	1374	0.168	0.183	LMTK1_HUMAN Serine/threonine-protein kinase LMTK1 OS=Homo sapiens OX=9606 GN=AATK PE=1 SV=2
4	Q80YE4	1.80e-137	461	1365	0.163	0.179	LMTK1_MOUSE Serine/threonine-protein kinase LMTK1 OS=Mus musculus OX=10090 GN=Aatk PE=1 SV=1
5	Q96Q04	4.23e-121	416	1460	0.162	0.166	LMTK3_HUMAN Serine/threonine-protein kinase LMTK3 OS=Homo sapiens OX=9606 GN=LMTK3 PE=1 SV=2
6	Q63604	7.52e-40	162	821	0.068	0.124	NTRK2_RAT BDNF/NT-3 growth factors receptor OS=Rattus norvegicus OX=10116 GN=Ntrk2 PE=1 SV=1
7	P15209	1.36e-39	162	821	0.068	0.124	NTRK2_MOUSE BDNF/NT-3 growth factors receptor OS=Mus musculus OX=10090 GN=Ntrk2 PE=1 SV=1
8	Q16620	2.19e-39	161	822	0.068	0.124	NTRK2_HUMAN BDNF/NT-3 growth factors receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=1 SV=1
9	Q548C2	2.19e-39	161	822	0.068	0.124	Q548C2_HUMAN Tyrosine-protein kinase receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=2 SV=1
10	F7DGW1	2.75e-39	160	838	0.068	0.122	F7DGW1_MACMU Tyrosine-protein kinase receptor OS=Macaca mulatta OX=9544 GN=NTRK2 PE=2 SV=2
11	Q6B515	4.84e-39	158	669	0.066	0.148	Q6B515_TAEGU Tyrosine-protein kinase receptor (Fragment) OS=Taeniopygia guttata OX=59729 PE=2 SV=1
12	A0A0R4ILA2	5.32e-39	159	799	0.065	0.123	A0A0R4ILA2_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=si:ch211-220b11.1 PE=3 SV=1
13	P04629	5.81e-39	159	796	0.065	0.122	NTRK1_HUMAN High affinity nerve growth factor receptor OS=Homo sapiens OX=9606 GN=NTRK1 PE=1 SV=4
14	P35739	8.64e-39	159	799	0.065	0.123	NTRK1_RAT High affinity nerve growth factor receptor OS=Rattus norvegicus OX=10116 GN=Ntrk1 PE=1 SV=1
15	Q3UFB7	8.95e-39	159	799	0.065	0.121	NTRK1_MOUSE High affinity nerve growth factor receptor OS=Mus musculus OX=10090 GN=Ntrk1 PE=1 SV=2
16	Q91987	2.77e-38	157	818	0.067	0.122	NTRK2_CHICK BDNF/NT-3 growth factors receptor OS=Gallus gallus OX=9031 GN=NTRK2 PE=1 SV=1
17	B7SNG4	4.72e-38	158	1353	0.070	0.078	B7SNG4_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=IRa PE=1 SV=1
18	Q9PWN6	1.91e-36	152	989	0.067	0.101	Q9PWN6_CHICK Tyrosine-protein kinase receptor (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
19	P06213	1.41e-35	150	1382	0.066	0.072	INSR_HUMAN Insulin receptor OS=Homo sapiens OX=9606 GN=INSR PE=1 SV=4
20	Q9PVZ4	1.89e-35	150	1362	0.065	0.071	INSR_XENLA Insulin receptor OS=Xenopus laevis OX=8355 GN=insr PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06293 Kdo	5.6e+02	11.3	Lipopolysaccharide kinase (Kdo/WaaP) family
2	PF00069 Pkinase	2.1e-22	91.4	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	8.3e-52	187.6	Protein tyrosine and serine/threonine kinase
4	PF05817 Ribophorin_II	8.7e+02	9.8	Oligosaccharyltransferase subunit Ribophorin II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297293

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341779	0.914	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
2	9606.ENSP00000358994	0.822	Unconventional myosin-VI
3	9606.ENSP00000484580	0.678	Protein phosphatase inhibitor 2
4	9606.ENSP00000368818	0.667	TOM1-like protein 2
5	9606.ENSP00000413697	0.642	Target of Myb protein 1
6	9606.ENSP00000463092	0.601	Beta-microseminoprotein
7	9606.ENSP00000288266	0.590	DCC-interacting protein 13-alpha
8	9606.ENSP00000419782	0.559	Cyclin-dependent-like kinase 5
9	9606.ENSP00000326031	0.557	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
10	9606.ENSP00000313391	0.554	Disabled homolog 2
11	9606.ENSP00000263991	0.520	EH domain-binding protein 1
12	9606.ENSP00000376753	0.518	PDZ domain-containing protein GIPC1
13	9606.ENSP00000399403	0.517	Kinesin light chain 2
14	9606.ENSP00000368022	0.508	Optineurin
15	9606.ENSP00000275300	0.504	Solute carrier family 22 member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0004674	0.994	protein serine/threonine kinase activity
GO:0019208	0.985	phosphatase regulator activity
GO:0008092	0.922	cytoskeletal protein binding
GO:0019888	0.920	protein phosphatase regulator activity
GO:0140678	0.918	molecular function inhibitor activity
GO:0017022	0.908	myosin binding
GO:0004864	0.908	protein phosphatase inhibitor activity
GO:0070853	0.554	myosin VI binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0008152	0.995	metabolic process
GO:0043170	0.992	macromolecule metabolic process
GO:0044237	0.961	cellular metabolic process
GO:0044238	0.927	primary metabolic process
GO:0006807	0.900	nitrogen compound metabolic process
GO:0019538	0.888	protein metabolic process
GO:0043412	0.887	macromolecule modification
GO:0065007	0.877	biological regulation
GO:0051649	0.876	establishment of localization in cell
GO:0050789	0.873	regulation of biological process
GO:0018193	0.868	peptidyl-amino acid modification
GO:0006810	0.833	transport
GO:0016192	0.822	vesicle-mediated transport
GO:0050794	0.812	regulation of cellular process
GO:0043112	0.812	receptor metabolic process
GO:0046907	0.808	intracellular transport
GO:0006796	0.774	phosphate-containing compound metabolic process
GO:0071702	0.593	organic substance transport
GO:0006468	0.465	protein phosphorylation
GO:0030001	0.425	metal ion transport
GO:0000041	0.420	transition metal ion transport
GO:0006826	0.398	iron ion transport
GO:0050896	0.369	response to stimulus
GO:0048518	0.348	positive regulation of biological process
GO:0019222	0.340	regulation of metabolic process
GO:0048522	0.317	positive regulation of cellular process
GO:0051668	0.304	localization within membrane
GO:0060255	0.302	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0012505	0.996	endomembrane system
GO:0031982	0.996	vesicle
GO:0031410	0.993	cytoplasmic vesicle
GO:0071944	0.907	cell periphery
GO:0005768	0.867	endosome
GO:0005634	0.859	nucleus
GO:0005829	0.848	cytosol
GO:0070013	0.803	intracellular organelle lumen
GO:0005886	0.703	plasma membrane
GO:0005794	0.683	Golgi apparatus
GO:0005769	0.675	early endosome
GO:0031090	0.500	organelle membrane
GO:0048471	0.475	perinuclear region of cytoplasm
GO:0055037	0.443	recycling endosome
GO:0032991	0.307	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]