StarFunc result for job id Q8IWV1

User Input

>input (398 residues)
MDGVTPTLSTIRGRTLESSTLHVTPRSLDRNKDQITNIFSGFAGLLAILLVVAVFCILWN
WNKRKKRQVPYLRVTVMPLLTLPQTRQRAKNIYDILPWRQEDLGRHESRSMRIFSTESLL
SRNSESPEHVPSQAGNAFQEHTAHIHATEYAVGIYDNAMVPQMCGNLTPSAHCINVRASR
DCASISSEDSHDYVNVPTAEEIAETLASTKSPSRNLFVLPSTQKLEFTEERDEGCGDAGD
CTSLYSPGAEDSDSLSNGEGSSQISNDYVNMTGLDLSAIQERQLWVAFQCCRDYENVPAA
DPSGSQQQAEKDVPSSNIGHVEDKTDDPGTHVQCVKRTFLASGDYADFQPFTQSEDSQMK
HREEMSNEDSSDYENVLTAKLGGRDSEQGPGTQLLPDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IWV1	1.000	1.000	3.544E-58	398	1.000	1.000	Q8IWV1.pdb.gz	LAX1_HUMAN Lymphocyte transmembrane adapter 1 OS=Homo sapiens OX=9606 GN=LAX1 PE=1 SV=1
2	AFDB:Q8BHB3	0.149	0.147	3.802E-24	407	0.518	0.506	Q8BHB3.pdb.gz	LAX1_MOUSE Lymphocyte transmembrane adapter 1 OS=Mus musculus OX=10090 GN=Lax1 PE=2 SV=2
3	AFDB:Q6NYV7	0.092	0.049	1.178E-2	1001	0.146	0.058	Q6NYV7.pdb.gz	Q6NYV7_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=2 SV=1
4	AFDB:O35464	0.110	0.052	3.795E-2	1031	0.143	0.055	O35464.pdb.gz	SEM6A_MOUSE Semaphorin-6A OS=Mus musculus OX=10090 GN=Sema6a PE=1 SV=2
5	AFDB:E3W9A6	0.110	0.046	8.480E-2	1064	0.156	0.058	E3W9A6.pdb.gz	E3W9A6_DANRE Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6E OS=Danio rerio OX=7955 GN=bZ1N7.1 PE=2 SV=1
6	AFDB:F1RCA4	0.099	0.082	9.815E-2	492	0.151	0.122	F1RCA4.pdb.gz
7	AFDB:A0A2R8QC01	0.103	0.081	1.414E-1	526	0.146	0.110	A0A2R8QC01.pdb.gz	A0A2R8QC01_DANRE ETS variant transcription factor 5b OS=Danio rerio OX=7955 GN=cb805 PE=3 SV=1
8	AFDB:B9VQL3	0.100	0.073	1.895E-1	565	0.141	0.099	B9VQL3.pdb.gz
9	AFDB:Q8CDG5	0.075	0.053	3.161E-1	640	0.143	0.089	Q8CDG5.pdb.gz	CRERF_MOUSE CREB3 regulatory factor OS=Mus musculus OX=10090 GN=Crebrf PE=2 SV=1
10	AFDB:Q9WTL3	0.095	0.046	3.400E-1	960	0.143	0.059	Q9WTL3.pdb.gz	SEM6C_RAT Semaphorin-6C OS=Rattus norvegicus OX=10116 GN=Sema6c PE=2 SV=1
11	PDB:6c24C	0.049	0.107	9.195	148	0.038	0.101	6c24C.pdb.gz	Structures of human PRC2 with its cofactors AEBP2 and JARID2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IWV1	0.0	833	398	1.000	1.000	LAX1_HUMAN Lymphocyte transmembrane adapter 1 OS=Homo sapiens OX=9606 GN=LAX1 PE=1 SV=1
2	Q8BHB3	3.04e-120	356	407	0.518	0.506	LAX1_MOUSE Lymphocyte transmembrane adapter 1 OS=Mus musculus OX=10090 GN=Lax1 PE=2 SV=2
3	P47108	1.6	33.5	1174	0.043	0.014	URB2_YEAST Nucleolar pre-ribosomal-associated protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URB2 PE=1 SV=1
4	Q8MVX7	5.0	30.4	140	0.050	0.143	Q8MVX7_DROME Odorant binding protein a OS=Drosophila melanogaster OX=7227 GN=Obp56i PE=2 SV=1
5	Q4V3N1	6.0	30.4	140	0.050	0.143	Q4V3N1_DROME IP02285p OS=Drosophila melanogaster OX=7227 GN=Obp56i PE=2 SV=1
6	Q9W0Y8	9.5	31.2	2844	0.035	0.005	SCN60_DROME Sodium channel protein 60E OS=Drosophila melanogaster OX=7227 GN=NaCP60E PE=2 SV=6

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07584 BatA	1.3e+02	14.3	Aerotolerance regulator N-terminal
2	PF15234 LAT	9.3	17.5	Linker for activation of T-cells
3	PF15681 LAX	2.3e-193	653.3	Lymphocyte activation family X
4	PF11670 MSP1a	3.2e+02	12.0	Major surface protein 1a (MSP1a)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406970

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376345	0.966	Growth factor receptor-bound protein 2
2	9606.ENSP00000295756	0.880	T-cell receptor-associated transmembrane adapter 1
3	9606.ENSP00000300935	0.878	Ras-related protein Rab-8A
4	9606.ENSP00000403459	0.734	Growth factor receptor-bound protein 7
5	9606.ENSP00000339186	0.684	GRB2-related adapter protein 2
6	9606.ENSP00000420494	0.670	Linker for activation of T-cells family member 2
7	9606.ENSP00000337825	0.635	Tyrosine-protein kinase Lck
8	9606.ENSP00000345295	0.615	SH2 domain containing 4B
9	9606.ENSP00000378845	0.549	Linker for activation of T cells
10	9606.ENSP00000264972	0.533	Tyrosine-protein kinase ZAP-70
11	9606.ENSP00000385510	0.511	G-protein-signaling modulator 2
12	9606.ENSP00000276431	0.505	Tumor necrosis factor receptor superfamily member 10B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042169	1.000	SH2 domain binding
GO:0019901	1.000	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0007165	0.986	signal transduction
GO:0031323	0.967	regulation of cellular metabolic process
GO:0030155	0.965	regulation of cell adhesion
GO:0060255	0.963	regulation of macromolecule metabolic process
GO:0048519	0.958	negative regulation of biological process
GO:0035556	0.954	intracellular signal transduction
GO:0051174	0.935	regulation of phosphorus metabolic process
GO:0007162	0.935	negative regulation of cell adhesion
GO:0002682	0.932	regulation of immune system process
GO:0019220	0.928	regulation of phosphate metabolic process
GO:0010563	0.928	negative regulation of phosphorus metabolic process
GO:0022407	0.925	regulation of cell-cell adhesion
GO:0009966	0.925	regulation of signal transduction
GO:0071901	0.921	negative regulation of protein serine/threonine kinase activity
GO:0002694	0.906	regulation of leukocyte activation
GO:1902531	0.898	regulation of intracellular signal transduction
GO:0051249	0.895	regulation of lymphocyte activation
GO:0009968	0.889	negative regulation of signal transduction
GO:1902532	0.884	negative regulation of intracellular signal transduction
GO:0002376	0.846	immune system process
GO:0022408	0.842	negative regulation of cell-cell adhesion
GO:0048518	0.839	positive regulation of biological process
GO:0043405	0.838	regulation of MAP kinase activity
GO:0043409	0.836	negative regulation of MAPK cascade
GO:0032501	0.808	multicellular organismal process
GO:0043407	0.797	negative regulation of MAP kinase activity
GO:0046649	0.783	lymphocyte activation
GO:0050863	0.631	regulation of T cell activation
GO:1903037	0.585	regulation of leukocyte cell-cell adhesion
GO:0007166	0.571	cell surface receptor signaling pathway
GO:0048522	0.508	positive regulation of cellular process
GO:0006955	0.499	immune response
GO:0002684	0.495	positive regulation of immune system process
GO:0002683	0.481	negative regulation of immune system process
GO:0048584	0.460	positive regulation of response to stimulus
GO:0050778	0.441	positive regulation of immune response
GO:1903038	0.421	negative regulation of leukocyte cell-cell adhesion
GO:0042113	0.390	B cell activation
GO:0051250	0.387	negative regulation of lymphocyte activation
GO:0050868	0.384	negative regulation of T cell activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0005794	0.998	Golgi apparatus
GO:0005634	0.372	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]