StarFunc result for job id Q8IWV7

User Input

>input (1749 residues)
MADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLE
KQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCGRVFKSGETTYSCRDCAIDPT
CVLCMDCFQDSVHKNHRYKMHTSTGGGFCDCGDTEAWKTGPFCVNHEPGRAGTIKENSRC
PLNEEVIVQARKIFPSVIKYVVEMTIWEEEKELPPELQIREKNERYYCVLFNDEHHSYDH
VIYSLQRALDCELAEAQLHTTAIDKEGRRAVKAGAYAACQEAKEDIKSHSENVSQHPLHV
EVLHSEIMAHQKFALRLGSWMNKIMSYSSDFRQIFCQACLREEPDSENPCLISRLMLWDA
KLYKGARKILHELIFSSFFMEMEYKKLFAMEFVKYYKQLQKEYISDDHDRSISITALSVQ
MFTVPTLARHLIEEQNVISVITETLLEVLPEYLDRNNKFNFQGYSQDKLGRVYAVICDLK
YILISKPTIWTERLRMQFLEGFRSFLKILTCMQGMEEIRRQVGQHIEVDPDWEAAIAIQM
QLKNILLMFQEWCACDEELLLVAYKECHKAVMRCSTSFISSSKTVVQSCGHSLETKSYRV
SEDLVSIHLPLSRTLAGLHVRLSRLGAVSRLHEFVSFEDFQVEVLVEYPLRCLVLVAQVV
AEMWRRNGLSLISQVFYYQDVKCREEMYDKDIIMLQIGASLMDPNKFLLLVLQRYELAEA
FNKTISTKDQDLIKQYNTLIEEMLQVLIYIVGERYVPGVGNVTKEEVTMREIIHLLCIEP
MPHSAIAKNLPENENNETGLENVINKVATFKKPGVSGHGVYELKDESLKDFNMYFYHYSK
TQHSKAEHMQKKRRKQENKDEALPPPPPPEFCPAFSKVINLLNCDIMMYILRTVFERAID
TDSNLWTEGMLQMAFHILALGLLEEKQQLQKAPEEEVTFDFYHKASRLGSSAMNIQMLLE
KLKGIPQLEGQKDMITWILQMFDTVKRLREKSCLIVATTSGSESIKNDEITHDKEKAERK
RKAEAARLHRQKIMAQMSALQKNFIETHKLMYDNTSEMPGKEDSIMEEESTPAVSDYSRI
ALGPKRGPSVTEKEVLTCILCQEEQEVKIENNAMVLSACVQKSTALTQHRGKPIELSGEA
LDPLFMDPDLAYGTYTGSCGHVMHAVCWQKYFEAVQLSSQQRIHVDLFDLESGEYLCPLC
KSLCNTVIPIIPLQPQKINSENADALAQLLTLARWIQTVLARISGYNIRHAKGENPIPIF
FNQGMGDSTLEFHSILSFGVESSIKYSNSIKEMVILFATTIYRIGLKVPPDERDPRVPML
TWSTCAFTIQAIENLLGDEGKPLFGALQNRQHNGLKALMQFAVAQRITCPQVLIQKHLVR
LLSVVLPNIKSEDTPCLLSIDLFHVLVGAVLAFPSLYWDDPVDLQPSSVSSSYNHLYLFH
LITMAHMLQILLTVDTGLPLAQVQEDSEEAHSASSFFAEISQYTSGSIGCDIPGWYLWVS
LKNGITPYLRCAALFFHYLLGVTPPEELHTNSAEGEYSALCSYLSLPTNLFLLFQEYWDT
VRPLLQRWCADPALLNCLKQKNTVVRYPRKRNSLIELPDDYSCLLNQASHFRCPRSADDE
RKHPVLCLFCGAILCSQNICCQEIVNGEEVGACIFHALHCGAGVCIFLKIRECRVVLVEG
KARGCAYPAPYLDEYGETDPGLKRGNPLHLSRERYRKLHLVWQQHCIIEEIARSQETNQM
LFGFNWQLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O70481	0.974	0.970	0.000	1757	0.924	0.920	O70481.pdb.gz	UBR1_MOUSE E3 ubiquitin-protein ligase UBR1 OS=Mus musculus OX=10090 GN=Ubr1 PE=1 SV=2
2	AFDB:Q6WKZ8	0.922	0.919	0.000	1755	0.464	0.463	Q6WKZ8.pdb.gz	UBR2_MOUSE E3 ubiquitin-protein ligase UBR2 OS=Mus musculus OX=10090 GN=Ubr2 PE=1 SV=2
3	AFDB:P91133	0.813	0.698	3.600E-102	2058	0.295	0.251	P91133.pdb.gz	UBR1_CAEEL E3 ubiquitin-protein ligase ubr-1 OS=Caenorhabditis elegans OX=6239 GN=ubr-1 PE=1 SV=2
4	AFDB:O60152	0.744	0.670	1.573E-69	1958	0.238	0.213	O60152.pdb.gz	UBR1_SCHPO E3 ubiquitin-protein ligase ubr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubr1 PE=3 SV=1
5	AFDB:O13731	0.728	0.628	1.705E-66	2052	0.217	0.185	O13731.pdb.gz	UBR11_SCHPO E3 ubiquitin-protein ligase ubr11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubr11 PE=1 SV=1
6	AFDB:F1QJX5	0.654	0.617	3.751E-59	1863	0.208	0.195	F1QJX5.pdb.gz	UBR3_DANRE E3 ubiquitin-protein ligase ubr3 OS=Danio rerio OX=7955 GN=ubr3 PE=2 SV=2
7	AFDB:D4A7F0	0.618	0.577	9.820E-59	1890	0.217	0.201	D4A7F0.pdb.gz	D4A7F0_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Ubr3 PE=1 SV=4
8	AFDB:F4KCC2	0.647	0.573	2.000E-58	2006	0.219	0.191	F4KCC2.pdb.gz	PRT6_ARATH E3 ubiquitin-protein ligase PRT6 OS=Arabidopsis thaliana OX=3702 GN=PRT6 PE=1 SV=1
9	AFDB:A0A1D8PLP8	0.589	0.579	6.705E-54	1787	0.188	0.184	A0A1D8PLP8.pdb.gz	A0A1D8PLP8_CANAL E3 ubiquitin-protein ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBR1 PE=3 SV=1
10	AFDB:P19812	0.624	0.565	1.017E-51	1950	0.185	0.166	P19812.pdb.gz	UBR1_YEAST E3 ubiquitin-protein ligase UBR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBR1 PE=1 SV=1
11	PDB:7mexA	0.654	0.658	1.134E-46	1737	0.174	0.176	7mexA.pdb.gz	Structural insights into Ubr1-mediated N-degron polyubiquitination.
12	PDB:7sicA	0.097	0.074	6.314E-5	2773	0.104	0.066	7sicA.pdb.gz	Structure of the human ATM kinase and mechanism of Nbs1 binding.
13	PDB:7w7gB	0.082	0.083	2.512E-4	1711	0.093	0.095	7w7gB.pdb.gz	Structure and mechanism of NALCN-FAM155A-UNC79-UNC80 channel complex.
14	PDB:7sglA	0.114	0.065	3.367E-4	3852	0.095	0.043	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
15	PDB:7mqaLM	0.082	0.074	3.661E-4	2041	0.084	0.072	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7u9tA	0.118	0.066	4.151E-4	4229	0.101	0.042	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
17	PDB:6tc0C	0.118	0.172	4.328E-4	994	0.065	0.115	6tc0C.pdb.gz
18	PDB:7qenD	0.082	0.104	5.117E-4	1050	0.063	0.105	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
19	PDB:7q2xD	0.091	0.115	5.563E-4	994	0.058	0.103	7q2xD.pdb.gz	Clamping of DNA shuts the condensin neck gate.
20	PDB:7wo9A	0.091	0.098	5.801E-4	1581	0.094	0.104	7wo9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70481	0.0	3359	1757	0.926	0.921	UBR1_MOUSE E3 ubiquitin-protein ligase UBR1 OS=Mus musculus OX=10090 GN=Ubr1 PE=1 SV=2
2	Q6WKZ8	0.0	1616	1755	0.471	0.469	UBR2_MOUSE E3 ubiquitin-protein ligase UBR2 OS=Mus musculus OX=10090 GN=Ubr2 PE=1 SV=2
3	Q8IWV7	0.0	3652	1749	1.000	1.000	UBR1_HUMAN E3 ubiquitin-protein ligase UBR1 OS=Homo sapiens OX=9606 GN=UBR1 PE=1 SV=1
4	Q8IWV8	0.0	1628	1755	0.475	0.473	UBR2_HUMAN E3 ubiquitin-protein ligase UBR2 OS=Homo sapiens OX=9606 GN=UBR2 PE=1 SV=1
5	P91133	9.93e-101	362	2058	0.157	0.134	UBR1_CAEEL E3 ubiquitin-protein ligase ubr-1 OS=Caenorhabditis elegans OX=6239 GN=ubr-1 PE=1 SV=2
6	O60152	1.45e-46	187	1958	0.133	0.119	UBR1_SCHPO E3 ubiquitin-protein ligase ubr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubr1 PE=3 SV=1
7	O13731	1.18e-39	164	2052	0.084	0.072	UBR11_SCHPO E3 ubiquitin-protein ligase ubr11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubr11 PE=1 SV=1
8	F1QJX5	2.64e-28	127	1863	0.084	0.079	UBR3_DANRE E3 ubiquitin-protein ligase ubr3 OS=Danio rerio OX=7955 GN=ubr3 PE=2 SV=2
9	Q5U430	3.89e-27	123	1889	0.083	0.077	UBR3_MOUSE E3 ubiquitin-protein ligase UBR3 OS=Mus musculus OX=10090 GN=Ubr3 PE=1 SV=3
10	D4A7F0	1.88e-24	114	1889	0.083	0.077	D4A7F0_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Ubr3 PE=1 SV=4
11	F4KCC2	8.78e-20	99.4	2006	0.064	0.056	PRT6_ARATH E3 ubiquitin-protein ligase PRT6 OS=Arabidopsis thaliana OX=3702 GN=PRT6 PE=1 SV=1
12	M9PDZ8	9.12e-18	92.8	2236	0.043	0.034	M9PDZ8_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=Ubr3 PE=1 SV=1
13	Q9W3M3	1.04e-17	92.8	2219	0.043	0.034	UBR3_DROME E3 ubiquitin-protein ligase Ubr3 OS=Drosophila melanogaster OX=7227 GN=Ubr3 PE=1 SV=4
14	P19812	7.95e-17	89.7	1950	0.060	0.054	UBR1_YEAST E3 ubiquitin-protein ligase UBR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBR1 PE=1 SV=1
15	Q07963	1.60e-13	79.0	1872	0.076	0.071	UBR2_YEAST E3 ubiquitin-protein ligase UBR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBR2 PE=1 SV=1
16	A0A1D8PLP8	2.98e-13	78.2	1787	0.062	0.061	A0A1D8PLP8_CANAL E3 ubiquitin-protein ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBR1 PE=3 SV=1
17	Q8IK43	2.3	35.0	299	0.015	0.087	Q8IK43_PLAF7 Stevor OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1479500 PE=4 SV=1
18	F4KCN6	2.5	33.9	171	0.016	0.164	F4KCN6_ARATH Ubiquitin receptor RAD23 OS=Arabidopsis thaliana OX=3702 GN=At5g16090 PE=3 SV=1
19	Q9U5M0	3.8	34.3	301	0.014	0.083	Q9U5M0_PLAF7 Stevor OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0324600 PE=4 SV=1
20	Q8IBE5	4.0	34.3	296	0.014	0.084	Q8IBE5_PLAF7 Stevor OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0732000 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01637 ATPase_2	1.5e+02	13.7	ATPase domain predominantly from Archaea
2	PF02617 ClpS	1.1e-16	71.7	ATP-dependent Clp protease adaptor protein ClpS
3	PF18995 PRT6_C	1.4e-92	322.6	Proteolysis_6 C-terminal
4	PF02207 zf-UBR	2.4e-17	74.1	Putative zinc finger in N-recognin (UBR box)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290650

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265339	0.989	Ubiquitin-conjugating enzyme E2 B
2	9606.ENSP00000360613	0.968	Ubiquitin-conjugating enzyme E2 A
3	9606.ENSP00000373696	0.957	E3 ubiquitin-protein ligase TRIP12
4	9606.ENSP00000482313	0.934	ATP-dependent DNA helicase Q4
5	9606.ENSP00000274140	0.887	E3 ubiquitin-protein ligase MARCH6
6	9606.ENSP00000429084	0.875	E3 ubiquitin-protein ligase UBR5
7	9606.ENSP00000478783	0.871	E3 ubiquitin-protein ligase listerin
8	9606.ENSP00000224652	0.855	Arginyl-tRNA--protein transferase 1
9	9606.ENSP00000381717	0.846	Ubiquitin-conjugating enzyme E2 D2
10	9606.ENSP00000362774	0.836	Roquin-2
11	9606.ENSP00000364403	0.835	E3 ubiquitin-protein ligase UBR4
12	9606.ENSP00000484713	0.818	WASH complex subunit 4
13	9606.ENSP00000238789	0.804	ATPase family, AAA domain containing 2B
14	9606.ENSP00000366395	0.751	E3 ubiquitin-protein ligase synoviolin
15	9606.ENSP00000013070	0.750	Putative E3 ubiquitin-protein ligase UBR7
16	9606.ENSP00000264926	0.748	E3 ubiquitin-protein ligase RAD18
17	9606.ENSP00000309198	0.748	Ubiquitin-protein ligase E3C
18	9606.ENSP00000363019	0.735	Ubiquitin-conjugating enzyme E2 D1
19	9606.ENSP00000360116	0.733	Ubiquitin-conjugating enzyme E2 U
20	9606.ENSP00000275034	0.726	PH-interacting protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0043167	0.995	ion binding
GO:0036094	0.991	small molecule binding
GO:0043168	0.988	anion binding
GO:0016597	0.984	amino acid binding
GO:0061630	0.490	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0050794	0.987	regulation of cellular process
GO:0044237	0.987	cellular metabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0043170	0.978	macromolecule metabolic process
GO:1901564	0.975	organonitrogen compound metabolic process
GO:0048523	0.968	negative regulation of cellular process
GO:0030163	0.966	protein catabolic process
GO:0044260	0.965	cellular macromolecule metabolic process
GO:0051716	0.964	cellular response to stimulus
GO:0006508	0.959	proteolysis
GO:0048583	0.952	regulation of response to stimulus
GO:0042221	0.950	response to chemical
GO:0006511	0.946	ubiquitin-dependent protein catabolic process
GO:0010033	0.928	response to organic substance
GO:0023051	0.891	regulation of signaling
GO:0010646	0.891	regulation of cell communication
GO:0009966	0.870	regulation of signal transduction
GO:0010243	0.843	response to organonitrogen compound
GO:0023057	0.815	negative regulation of signaling
GO:0010648	0.815	negative regulation of cell communication
GO:0032006	0.807	regulation of TOR signaling
GO:0048585	0.801	negative regulation of response to stimulus
GO:0001101	0.783	response to acid chemical
GO:0043200	0.731	response to amino acid
GO:0009968	0.708	negative regulation of signal transduction
GO:0070887	0.633	cellular response to chemical stimulus
GO:0009719	0.596	response to endogenous stimulus
GO:0071229	0.531	cellular response to acid chemical
GO:0071495	0.522	cellular response to endogenous stimulus
GO:0043412	0.412	macromolecule modification
GO:0071310	0.390	cellular response to organic substance
GO:0036211	0.377	protein modification process
GO:0032007	0.372	negative regulation of TOR signaling
GO:0071230	0.335	cellular response to amino acid stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	0.997	catalytic complex
GO:0140535	0.996	intracellular protein-containing complex
GO:1990234	0.994	transferase complex
GO:0000151	0.972	ubiquitin ligase complex
GO:0110165	0.966	cellular anatomical entity
GO:0005622	0.959	intracellular anatomical structure
GO:0005829	0.947	cytosol
GO:0043229	0.933	intracellular organelle
GO:0005634	0.861	nucleus
GO:1905369	0.722	endopeptidase complex
GO:0000502	0.714	proteasome complex
GO:0031981	0.648	nuclear lumen
GO:0005654	0.602	nucleoplasm
GO:0043228	0.566	non-membrane-bounded organelle
GO:0043232	0.557	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]