StarFunc result for job id Q8IWV8

User Input

>input (1755 residues)
MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQK
EDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCGRVFKVGEPTYSCRDCAVDPT
CVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHELNTSEIEEEEDPL
VHLSEDVIARTYNIFAITFRYAVEILTWEKESELPADLEMVEKSDTYYCMLFNDEVHTYE
QVIYTLQKAVNCTQKEAIGFATTVDRDGRRSVRYGDFQYCEQAKSVIVRNTSRQTKPLKV
QVMHSSIVAHQNFGLKLLSWLGSIIGYSDGLRRILCQVGLQEGPDGENSSLVDRLMLSDS
KLWKGARSVYHQLFMSSLLMDLKYKKLFAVRFAKNYQQLQRDFMEDDHERAVSVTALSVQ
FFTAPTLARMLITEENLMSIIIKTFMDHLRHRDAQGRFQFERYTALQAFKFRRVQSLILD
LKYVLISKPTEWSDELRQKFLEGFDAFLELLKCMQGMDPITRQVGQHIEMEPEWEAAFTL
QMKLTHVISMMQDWCASDEKVLIEAYKKCLAVLMQCHGGYTDGEQPITLSICGHSVETIR
YCVSQEKVSIHLPVSRLLAGLHVLLSKSEVAYKFPELLPLSELSPPMLIEHPLRCLVLCA
QVHAGMWRRNGFSLVNQIYYYHNVKCRREMFDKDVVMLQTGVSMMDPNHFLMIMLSRFEL
YQIFSTPDYGKRFSSEITHKDVVQQNNTLIEEMLYLIIMLVGERFSPGVGQVNATDEIKR
EIIHQLSIKPMAHSELVKSLPEDENKETGMESVIEAVAHFKKPGLTGRGMYELKPECAKE
FNLYFYHFSRAEQSKAEEAQRKLKRQNREDTALPPPVLPPFCPLFASLVNILQSDVMLCI
MGTILQWAVEHNGYAWSESMLQRVLHLIGMALQEEKQHLENVTEEHVVTFTFTQKISKPG
EAPKNSPSILAMLETLQNAPYLEVHKDMIRWILKTFNAVKKMRESSPTSPVAETEGTIME
ESSRDKDKAERKRKAEIARLRREKIMAQMSEMQRHFIDENKELFQQTLELDASTSAVLDH
SPVASDMTLTALGPAQTQVPEQRQFVTCILCQEEQEVKVESRAMVLAAFVQRSTVLSKNR
SKFIQDPEKYDPLFMHPDLSCGTHTSSCGHIMHAHCWQRYFDSVQAKEQRRQQRLRLHTS
YDVENGEFLCPLCECLSNTVIPLLLPPRNIFNNRLNFSDQPNLTQWIRTISQQIKALQFL
RKEESTPNNASTKNSENVDELQLPEGFRPDFRPKIPYSESIKEMLTTFGTATYKVGLKVH
PNEEDPRVPIMCWGSCAYTIQSIERILSDEDKPLFGPLPCRLDDCLRSLTRFAAAHWTVA
SVSVVQGHFCKLFASLVPNDSHEELPCILDIDMFHLLVGLVLAFPALQCQDFSGISLGTG
DLHIFHLVTMAHIIQILLTSCTEENGMDQENPPCEEESAVLALYKTLHQYTGSALKEIPS
GWHLWRSVRAGIMPFLKCSALFFHYLNGVPSPPDIQVPGTSHFEHLCSYLSLPNNLICLF
QENSEIMNSLIESWCRNSEVKRYLEGERDAIRYPRESNKLINLPEDYSSLINQASNFSCP
KSGGDKSRAPTLCLVCGSLLCSQSYCCQTELEGEDVGACTAHTYSCGSGVGIFLRVRECQ
VLFLAGKTKGCFYSPPYLDDYGETDQGLRRGNPLHLCKERFKKIQKLWHQHSVTEEIGHA
QEANQTLVGIDWQHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O70481	0.909	0.908	0.000	1757	0.466	0.466	O70481.pdb.gz	UBR1_MOUSE E3 ubiquitin-protein ligase UBR1 OS=Mus musculus OX=10090 GN=Ubr1 PE=1 SV=2
2	AFDB:P91133	0.834	0.717	0.000	2058	0.303	0.259	P91133.pdb.gz	UBR1_CAEEL E3 ubiquitin-protein ligase ubr-1 OS=Caenorhabditis elegans OX=6239 GN=ubr-1 PE=1 SV=2
3	AFDB:Q6WKZ8	0.992	0.992	0.000	1755	0.905	0.905	Q6WKZ8.pdb.gz	UBR2_MOUSE E3 ubiquitin-protein ligase UBR2 OS=Mus musculus OX=10090 GN=Ubr2 PE=1 SV=2
4	AFDB:O60152	0.714	0.647	2.126E-70	1958	0.236	0.212	O60152.pdb.gz	UBR1_SCHPO E3 ubiquitin-protein ligase ubr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubr1 PE=3 SV=1
5	AFDB:O13731	0.712	0.617	1.649E-66	2052	0.217	0.186	O13731.pdb.gz	UBR11_SCHPO E3 ubiquitin-protein ligase ubr11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubr11 PE=1 SV=1
6	AFDB:F4KCC2	0.627	0.556	1.447E-58	2006	0.218	0.190	F4KCC2.pdb.gz	PRT6_ARATH E3 ubiquitin-protein ligase PRT6 OS=Arabidopsis thaliana OX=3702 GN=PRT6 PE=1 SV=1
7	AFDB:F1QJX5	0.649	0.615	5.328E-58	1863	0.211	0.199	F1QJX5.pdb.gz	UBR3_DANRE E3 ubiquitin-protein ligase ubr3 OS=Danio rerio OX=7955 GN=ubr3 PE=2 SV=2
8	AFDB:D4A7F0	0.593	0.555	6.996E-56	1890	0.198	0.184	D4A7F0.pdb.gz	D4A7F0_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Ubr3 PE=1 SV=4
9	AFDB:A0A1D8PLP8	0.569	0.560	3.078E-54	1787	0.186	0.182	A0A1D8PLP8.pdb.gz	A0A1D8PLP8_CANAL E3 ubiquitin-protein ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBR1 PE=3 SV=1
10	AFDB:P19812	0.606	0.552	5.098E-54	1950	0.193	0.173	P19812.pdb.gz	UBR1_YEAST E3 ubiquitin-protein ligase UBR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBR1 PE=1 SV=1
11	PDB:7mexA	0.595	0.600	1.354E-47	1737	0.185	0.187	7mexA.pdb.gz	Structural insights into Ubr1-mediated N-degron polyubiquitination.
12	PDB:7jq9A	0.111	0.093	4.252E-4	2427	0.096	0.070	7jq9A.pdb.gz
13	PDB:7qenD	0.076	0.099	4.434E-4	1050	0.054	0.090	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
14	PDB:7qfwA	0.065	0.105	4.824E-4	823	0.062	0.131	7qfwA.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
15	PDB:6xu2A	0.077	0.099	5.952E-4	1091	0.050	0.081	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
16	PDB:6q82A	0.119	0.165	8.690E-4	1027	0.056	0.095	6q82A.pdb.gz	Structural basis for the nuclear import and export functions of the biportin Pdr6/Kap122.
17	PDB:6fvbA	0.087	0.113	9.063E-4	1001	0.058	0.102	6fvbA.pdb.gz
18	PDB:6kwyc	0.125	0.122	1.439E-3	1811	0.091	0.088	6kwyc.pdb.gz	Cryo-EM structures of the human PA200 and PA200-20S complex reveal regulation of proteasome gate opening and two PA200 apertures.
19	PDB:6zhaA	0.075	0.048	1.566E-3	3707	0.105	0.050	6zhaA.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
20	PDB:3gb8A	0.112	0.162	1.633E-3	958	0.059	0.108	3gb8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70481	0.0	1636	1757	0.472	0.471	UBR1_MOUSE E3 ubiquitin-protein ligase UBR1 OS=Mus musculus OX=10090 GN=Ubr1 PE=1 SV=2
2	Q6WKZ8	0.0	3322	1755	0.905	0.905	UBR2_MOUSE E3 ubiquitin-protein ligase UBR2 OS=Mus musculus OX=10090 GN=Ubr2 PE=1 SV=2
3	Q8IWV7	0.0	1654	1749	0.473	0.475	UBR1_HUMAN E3 ubiquitin-protein ligase UBR1 OS=Homo sapiens OX=9606 GN=UBR1 PE=1 SV=1
4	Q8IWV8	0.0	3671	1755	1.000	1.000	UBR2_HUMAN E3 ubiquitin-protein ligase UBR2 OS=Homo sapiens OX=9606 GN=UBR2 PE=1 SV=1
5	P91133	1.10e-116	412	2058	0.167	0.142	UBR1_CAEEL E3 ubiquitin-protein ligase ubr-1 OS=Caenorhabditis elegans OX=6239 GN=ubr-1 PE=1 SV=2
6	O60152	4.23e-53	208	1958	0.146	0.131	UBR1_SCHPO E3 ubiquitin-protein ligase ubr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubr1 PE=3 SV=1
7	O13731	4.53e-42	172	2052	0.132	0.113	UBR11_SCHPO E3 ubiquitin-protein ligase ubr11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubr11 PE=1 SV=1
8	D4A7F0	2.56e-33	144	1889	0.107	0.100	D4A7F0_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Ubr3 PE=1 SV=4
9	Q5U430	4.78e-33	143	1889	0.109	0.102	UBR3_MOUSE E3 ubiquitin-protein ligase UBR3 OS=Mus musculus OX=10090 GN=Ubr3 PE=1 SV=3
10	A0A1D8PLP8	1.17e-30	135	1787	0.163	0.160	A0A1D8PLP8_CANAL E3 ubiquitin-protein ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBR1 PE=3 SV=1
11	F1QJX5	3.22e-29	130	1863	0.100	0.094	UBR3_DANRE E3 ubiquitin-protein ligase ubr3 OS=Danio rerio OX=7955 GN=ubr3 PE=2 SV=2
12	P19812	3.10e-28	127	1950	0.117	0.106	UBR1_YEAST E3 ubiquitin-protein ligase UBR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBR1 PE=1 SV=1
13	F4KCC2	6.24e-24	113	2006	0.062	0.054	PRT6_ARATH E3 ubiquitin-protein ligase PRT6 OS=Arabidopsis thaliana OX=3702 GN=PRT6 PE=1 SV=1
14	Q07963	1.40e-19	99.0	1872	0.098	0.092	UBR2_YEAST E3 ubiquitin-protein ligase UBR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBR2 PE=1 SV=1
15	M9PDZ8	6.24e-19	96.7	2236	0.041	0.032	M9PDZ8_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=Ubr3 PE=1 SV=1
16	Q9W3M3	6.78e-19	96.7	2219	0.041	0.032	UBR3_DROME E3 ubiquitin-protein ligase Ubr3 OS=Drosophila melanogaster OX=7227 GN=Ubr3 PE=1 SV=4
17	Q9VU08	0.19	39.3	3919	0.024	0.011	VP13D_DROME Intermembrane lipid transfer protein Vps13D OS=Drosophila melanogaster OX=7227 GN=Vps13D PE=1 SV=3
18	P9WPV5	0.28	37.0	171	0.018	0.187	ATPF_MYCTU ATP synthase subunit b OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=atpF PE=1 SV=1
19	G5E8Q8	2.3	35.4	1348	0.026	0.034	AGRF5_MOUSE Adhesion G protein-coupled receptor F5 OS=Mus musculus OX=10090 GN=Adgrf5 PE=1 SV=1
20	Q20849	2.3	35.8	2049	0.014	0.012	KNTC1_CAEEL Kinetochore-associated protein rod-1 OS=Caenorhabditis elegans OX=6239 GN=rod-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02617 ClpS	1.1e-19	81.3	ATP-dependent Clp protease adaptor protein ClpS
2	PF18995 PRT6_C	5.4e-98	340.5	Proteolysis_6 C-terminal
3	PF12861 zf-ANAPC11	2.2e+02	13.3	Anaphase-promoting complex subunit 11 RING-H2 finger
4	PF02207 zf-UBR	3e-17	73.8	Putative zinc finger in N-recognin (UBR box)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361990

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265339	0.991	Ubiquitin-conjugating enzyme E2 B
2	9606.ENSP00000360613	0.960	Ubiquitin-conjugating enzyme E2 A
3	9606.ENSP00000373696	0.948	E3 ubiquitin-protein ligase TRIP12
4	9606.ENSP00000224652	0.867	Arginyl-tRNA--protein transferase 1
5	9606.ENSP00000364403	0.864	E3 ubiquitin-protein ligase UBR4
6	9606.ENSP00000429084	0.836	E3 ubiquitin-protein ligase UBR5
7	9606.ENSP00000482313	0.817	ATP-dependent DNA helicase Q4
8	9606.ENSP00000274140	0.769	E3 ubiquitin-protein ligase MARCH6
9	9606.ENSP00000013070	0.758	Putative E3 ubiquitin-protein ligase UBR7
10	9606.ENSP00000323687	0.752	(E3-independent) E2 ubiquitin-conjugating enzyme
11	9606.ENSP00000382269	0.741	E3 ubiquitin-protein ligase HECTD1
12	9606.ENSP00000351273	0.739	Caspase-8
13	9606.ENSP00000360116	0.735	Ubiquitin-conjugating enzyme E2 U
14	9606.ENSP00000381717	0.723	Ubiquitin-conjugating enzyme E2 D2
15	9606.ENSP00000340648	0.706	E3 ubiquitin-protein ligase HUWE1
16	9606.ENSP00000478783	0.704	E3 ubiquitin-protein ligase listerin
17	9606.ENSP00000418734	0.703	Histone H2A deubiquitinase MYSM1
18	9606.ENSP00000392094	0.690	116 kDa U5 small nuclear ribonucleoprotein component
19	9606.ENSP00000309198	0.684	Ubiquitin-protein ligase E3C
20	9606.ENSP00000381577	0.665	Ubiquitin carboxyl-terminal hydrolase 34

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0016597	0.994	amino acid binding
GO:0061630	0.993	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0050896	0.990	response to stimulus
GO:0071704	0.986	organic substance metabolic process
GO:0044237	0.984	cellular metabolic process
GO:0051716	0.982	cellular response to stimulus
GO:0042221	0.981	response to chemical
GO:0006807	0.980	nitrogen compound metabolic process
GO:0048519	0.973	negative regulation of biological process
GO:0009966	0.970	regulation of signal transduction
GO:0044238	0.969	primary metabolic process
GO:0043170	0.963	macromolecule metabolic process
GO:0010033	0.953	response to organic substance
GO:0023057	0.947	negative regulation of signaling
GO:0010648	0.947	negative regulation of cell communication
GO:0032006	0.943	regulation of TOR signaling
GO:0009968	0.939	negative regulation of signal transduction
GO:0032007	0.932	negative regulation of TOR signaling
GO:0019538	0.908	protein metabolic process
GO:1901698	0.898	response to nitrogen compound
GO:0071495	0.874	cellular response to endogenous stimulus
GO:0044260	0.848	cellular macromolecule metabolic process
GO:0070887	0.835	cellular response to chemical stimulus
GO:0010243	0.808	response to organonitrogen compound
GO:1901700	0.806	response to oxygen-containing compound
GO:0006511	0.785	ubiquitin-dependent protein catabolic process
GO:0036211	0.766	protein modification process
GO:0071229	0.735	cellular response to acid chemical
GO:0071230	0.731	cellular response to amino acid stimulus
GO:0070647	0.714	protein modification by small protein conjugation or removal
GO:0032446	0.587	protein modification by small protein conjugation
GO:0016567	0.582	protein ubiquitination
GO:0019222	0.521	regulation of metabolic process
GO:0060255	0.476	regulation of macromolecule metabolic process
GO:0048518	0.348	positive regulation of biological process
GO:0080090	0.337	regulation of primary metabolic process
GO:0051171	0.336	regulation of nitrogen compound metabolic process
GO:0031323	0.336	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0032991	0.994	protein-containing complex
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0005829	0.991	cytosol
GO:0005634	0.968	nucleus
GO:0005654	0.963	nucleoplasm
GO:1902494	0.952	catalytic complex
GO:0140535	0.931	intracellular protein-containing complex
GO:0000151	0.750	ubiquitin ligase complex
GO:0005694	0.734	chromosome
GO:0000785	0.625	chromatin
GO:0016020	0.346	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]