StarFunc result for job id Q8IWX8

User Input

>input (916 residues)
MEMPLPPDDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYSYYKCKL
ALEQQQLICKQQTPELEPAATMPPLPQPPLAPAAPIPPAQGAPSMDELIQQSQWNLQQQE
QHLLALRQEQVTAAVAHAVEQQMQKLLEETQLDMNEFDNLLQPIIDTCTKDAISAGKNWM
FSNAKSPPHCELMAGHLRNRITADGAHFELRLHLIYLINDVLHHCQRKQARELLAALQKV
VVPIYCTSFLAVEEDKQQKIARLLQLWEKNGYFDDSIIQQLQSPALGLGQYQATLINEYS
SVVQPVQLAFQQQIQTLKTQHEEFVTSLAQQQQQQQQQQQQLQMPQMEAEVKATPPPPAP
PPAPAPAPAIPPTTQPDDSKPPIQMPGSSEYEAPGGVQDPAAAGPRGPGPHDQIPPNKPP
WFDQPHPVAPWGQQQPPEQPPYPHHQGGPPHCPPWNNSHEGMWGEQRGDPGWNGQRDAPW
NNQPDAAWNSQFEGPWNSQHEQPPWGGGQREPPFRMQRPPHFRGPFPPHQQHPQFNQPPH
PHNFNRFPPRFMQDDFPPRHPFERPPYPHRFDYPQGDFPAEMGPPHHHPGHRMPHPGINE
HPPWAGPQHPDFGPPPHGFNGQPPHMRRQGPPHINHDDPSLVPNVPYFDLPAGLMAPLVK
LEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAK
MRARRRKGQEKRNSGPSRSRSRSKSRGRSSSRSNSRSSKSSGSYSRSRSRSCSRSYSRSR
SRSRSRSRSSRSRSRSQSRSRSKSYSPGRRRRSRSRSPTPPSSAGLGSNSAPPIPDSRLG
EENKGHQMLVKMGWSGSGGLGAKEQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRN
KSYSFIARMKARDECK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZAX5	0.441	0.433	8.116E-101	935	0.951	0.932	D3ZAX5.pdb.gz	D3ZAX5_RAT Calcium homeostasis endoplasmic reticulum protein OS=Rattus norvegicus OX=10116 GN=Cherp PE=1 SV=3
2	AFDB:Q9TXS0	0.061	0.059	1.285E-4	968	0.121	0.115	Q9TXS0.pdb.gz	Q9TXS0_CAEEL FCH domain only protein 2 OS=Caenorhabditis elegans OX=6239 GN=fcho-1 PE=1 SV=1
3	AFDB:Q09822	0.063	0.063	4.370E-4	927	0.141	0.139	Q09822.pdb.gz	CDC15_SCHPO Cell division control protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc15 PE=1 SV=2
4	AFDB:F1M8L9	0.058	0.047	1.633E-3	1253	0.145	0.106	F1M8L9.pdb.gz	F1M8L9_RAT Rap guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Rapgef1 PE=1 SV=4
5	AFDB:P17672	0.072	0.056	1.971E-3	1355	0.170	0.115	P17672.pdb.gz	E75BA_DROME Ecdysone-induced protein 75B, isoform A OS=Drosophila melanogaster OX=7227 GN=Eip75B PE=2 SV=2
6	AFDB:Q9VHC4	0.060	0.050	2.614E-3	1133	0.099	0.080	Q9VHC4.pdb.gz	Q9VHC4_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FCHo2 PE=1 SV=3
7	AFDB:E1JGY9	0.057	0.056	5.296E-3	950	0.155	0.149	E1JGY9.pdb.gz	E1JGY9_DROME Missing-in-metastasis, isoform D OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
8	AFDB:A1Z7J7	0.084	0.067	6.393E-3	1240	0.134	0.099	A1Z7J7.pdb.gz	A1Z7J7_DROME Secretory 31, isoform A OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
9	AFDB:A0A0B4JD47	0.052	0.050	1.024E-2	977	0.153	0.143	A0A0B4JD47.pdb.gz	A0A0B4JD47_DROME Missing-in-metastasis, isoform E OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
10	AFDB:Q13625	0.063	0.052	1.423E-2	1128	0.163	0.132	Q13625.pdb.gz	ASPP2_HUMAN Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2
11	PDB:6ff7p	0.061	0.309	2.240E-2	175	0.027	0.143	6ff7p.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
12	PDB:4o9yA	0.048	0.022	7.617E-2	2490	0.046	0.017	4o9yA.pdb.gz
13	PDB:6ah0u	0.063	0.410	1.278E-1	124	0.029	0.218	6ah0u.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
14	PDB:5gm6Z	0.075	0.142	5.006E-1	447	0.024	0.049	5gm6Z.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:3pjaL	0.088	0.229	5.247E-1	223	0.029	0.121	3pjaL.pdb.gz
16	PDB:6gx9A	0.117	0.118	5.500E-1	912	0.034	0.034	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
17	PDB:3zc0B	0.069	0.201	5.765E-1	191	0.027	0.131	3zc0B.pdb.gz	Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
18	PDB:7qe7Y	0.059	0.090	6.043E-1	502	0.031	0.056	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:1qoyA	0.047	0.104	6.639E-1	303	0.037	0.112	1qoyA.pdb.gz
20	PDB:4c0qB	0.119	0.141	8.015E-1	749	0.040	0.049	4c0qB.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZAX5	0.0	1420	946	0.950	0.920	D3ZAX5_RAT Calcium homeostasis endoplasmic reticulum protein OS=Rattus norvegicus OX=10116 GN=Cherp PE=1 SV=3
2	Q8CGZ0	0.0	1430	936	0.952	0.932	CHERP_MOUSE Calcium homeostasis endoplasmic reticulum protein OS=Mus musculus OX=10090 GN=Cherp PE=1 SV=1
3	Q8IWX8	0.0	1864	916	1.000	1.000	CHERP_HUMAN Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3
4	Q9VEP9	6.31e-09	62.4	784	0.029	0.034	Q9VEP9_DROME GH03554p OS=Drosophila melanogaster OX=7227 GN=Sf3a1 PE=1 SV=1
5	Q8IWZ8	2.28e-08	60.5	645	0.033	0.047	SUGP1_HUMAN SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1 PE=1 SV=2
6	Q15459	2.67e-07	57.0	793	0.027	0.032	SF3A1_HUMAN Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1
7	E7ET15	9.73e-06	52.0	1028	0.071	0.063	E7ET15_HUMAN U2 snRNP associated SURP domain containing OS=Homo sapiens OX=9606 GN=U2SURP PE=1 SV=1
8	G5ECL3	1.06e-05	51.6	655	0.037	0.052	G5ECL3_CAEEL Pre-RNA processing 21 OS=Caenorhabditis elegans OX=6239 GN=prp-21 PE=1 SV=1
9	Q94C11	1.26e-05	51.2	443	0.027	0.056	SUGP1_ARATH SURP and G-patch domain-containing protein 1-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g52120 PE=1 SV=1
10	Q08CK9	1.36e-05	51.6	774	0.028	0.034	Q08CK9_DANRE Angiogenic factor with G patch and FHA domains 1 OS=Danio rerio OX=7955 GN=zgc:152959 PE=2 SV=1
11	Q55CI7	1.43e-05	51.2	595	0.035	0.054	Q55CI7_DICDI RNA-binding region RNP-1 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271014 PE=4 SV=1
12	O15042	1.48e-05	51.6	1029	0.071	0.063	SR140_HUMAN U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP PE=1 SV=2
13	O13900	4.02e-05	49.7	481	0.024	0.046	SA114_SCHPO Pre-mRNA-splicing factor sap114 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sap114 PE=1 SV=1
14	Q8GXN9	4.82e-04	46.6	930	0.028	0.028	TGH_ARATH G patch domain-containing protein TGH OS=Arabidopsis thaliana OX=3702 GN=TGH PE=1 SV=1
15	Q9NW75	7.11e-04	45.8	528	0.036	0.062	GPTC2_HUMAN G patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GPATCH2 PE=1 SV=1
16	Q147M4	0.002	43.9	301	0.033	0.100	Q147M4_ARATH At5g26610 OS=Arabidopsis thaliana OX=3702 GN=At5g26610 PE=1 SV=1
17	Q63627	0.006	42.7	1200	0.040	0.031	SCAF4_RAT SR-related and CTD-associated factor 4 OS=Rattus norvegicus OX=10116 GN=Scaf4 PE=1 SV=2
18	O95104	0.009	42.4	1147	0.040	0.032	SCAF4_HUMAN SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3
19	Q9P6R9	0.009	42.4	887	0.044	0.045	CWC22_SCHPO Pre-mRNA-splicing factor cwf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf22 PE=1 SV=3
20	Q9VRM6	0.009	42.4	1929	0.028	0.013	Q9VRM6_DROME Lethal (3) persistent salivary gland 2 OS=Drosophila melanogaster OX=7227 GN=l(3)psg2 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04818 CID	4.6e-23	93.2	CID domain
2	PF01585 G-patch	8.7e-09	46.5	G-patch domain
3	PF01805 Surp	1.7e-12	58.4	Surp module

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000439856

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418563	0.996	U2 snRNP-associated SURP motif-containing protein
2	9606.ENSP00000221494	0.983	Splicing factor 3A subunit 2
3	9606.ENSP00000434359	0.977	Poly(U)-binding-splicing factor PUF60
4	9606.ENSP00000335321	0.973	Splicing factor 3B subunit 1
5	9606.ENSP00000215793	0.951	Splicing factor 3A subunit 1
6	9606.ENSP00000388638	0.950	Splicing factor 45
7	9606.ENSP00000233468	0.945	Splicing factor 3B subunit 6
8	9606.ENSP00000400591	0.938	Small nuclear ribonucleoprotein E
9	9606.ENSP00000318861	0.934	Splicing factor 3B subunit 2
10	9606.ENSP00000336741	0.933	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15
11	9606.ENSP00000342374	0.932	Small nuclear ribonucleoprotein Sm D2
12	9606.ENSP00000266735	0.931	Small nuclear ribonucleoprotein F
13	9606.ENSP00000272348	0.929	Small nuclear ribonucleoprotein G
14	9606.ENSP00000305790	0.928	Splicing factor 3B subunit 3
15	9606.ENSP00000215829	0.921	Small nuclear ribonucleoprotein Sm D3
16	9606.ENSP00000300413	0.921	Small nuclear ribonucleoprotein Sm D1
17	9606.ENSP00000291552	0.890	U2 small nuclear RNA auxiliary factor 1
18	9606.ENSP00000271628	0.868	Splicing factor 3B subunit 4
19	9606.ENSP00000416534	0.867	Probable ATP-dependent RNA helicase DDX46
20	9606.ENSP00000253363	0.860	RNA-binding protein 39

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.986	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.987	biological regulation
GO:0050794	0.982	regulation of cellular process
GO:0009987	0.976	cellular process
GO:0048519	0.960	negative regulation of biological process
GO:0010646	0.924	regulation of cell communication
GO:0023051	0.920	regulation of signaling
GO:0048518	0.835	positive regulation of biological process
GO:0048522	0.825	positive regulation of cellular process
GO:0048523	0.758	negative regulation of cellular process
GO:0048583	0.587	regulation of response to stimulus
GO:0009966	0.568	regulation of signal transduction
GO:0097553	0.528	calcium ion transmembrane import into cytosol
GO:0051283	0.516	negative regulation of sequestering of calcium ion
GO:0051209	0.510	release of sequestered calcium ion into cytosol
GO:0071704	0.509	organic substance metabolic process
GO:0044238	0.478	primary metabolic process
GO:0044237	0.474	cellular metabolic process
GO:0006807	0.465	nitrogen compound metabolic process
GO:0043170	0.459	macromolecule metabolic process
GO:0006396	0.442	RNA processing
GO:0008285	0.432	negative regulation of cell population proliferation
GO:0048584	0.431	positive regulation of response to stimulus
GO:0050848	0.415	regulation of calcium-mediated signaling
GO:0050801	0.414	monoatomic ion homeostasis
GO:0007399	0.411	nervous system development
GO:0019725	0.409	cellular homeostasis
GO:0055080	0.403	monoatomic cation homeostasis
GO:0106056	0.403	regulation of calcineurin-mediated signaling
GO:0098771	0.398	inorganic ion homeostasis
GO:0070884	0.392	regulation of calcineurin-NFAT signaling cascade
GO:0030003	0.391	intracellular monoatomic cation homeostasis
GO:0050850	0.381	positive regulation of calcium-mediated signaling
GO:0055074	0.356	calcium ion homeostasis
GO:0006874	0.346	intracellular calcium ion homeostasis
GO:0060255	0.334	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0012505	0.885	endomembrane system
GO:0032991	0.766	protein-containing complex
GO:0031090	0.730	organelle membrane
GO:0005783	0.525	endoplasmic reticulum
GO:0098588	0.468	bounding membrane of organelle
GO:0031984	0.388	organelle subcompartment
GO:0005789	0.368	endoplasmic reticulum membrane
GO:0048471	0.333	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]