StarFunc result for job id Q8IWY4

User Input

>input (988 residues)
MGAAAVRWHLCVLLALGTRGRLAGGSGLPGSVDVDECSEGTDDCHIDAICQNTPKSYKCL
CKPGYKGEGKQCEDIDECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDGHNCLDVDE
CQDNNGGCQQICVNAMGSYECQCHSGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRET
PKGGVACDCRPGFDLAQNQKDCTLTCNYGNGGCQHSCEDTDTGPTCGCHQKYALHSDGRT
CIETCAVNNGGCDRTCKDTATGVRCSCPVGFTLQPDGKTCKDINECLVNNGGCDHFCRNT
VGSFECGCRKGYKLLTDERTCQDIDECSFERTCDHICINSPGSFQCLCHRGYILYGTTHC
GDVDECSMSNGSCDQGCVNTKGSYECVCPPGRRLHWNGKDCVETGKCLSRAKTSPRAQLS
CSKAGGVESCFLSCPAHTLFVPDSENSYVLSCGVPGPQGKALQKRNGTSSGLGPSCSDAP
TTPIKQKARFKIRDAKCHLRPHSQARAKETARQPLLDHCHVTFVTLKCDSSKKRRRGRKS
PSKEVSHITAEFEIETKMEEASDTCEADCLRKRAEQSLQAAIKTLRKSIGRQQFYVQVSG
TEYEVAQRPAKALEGQGACGAGQVLQDSKCVACGPGTHFGGELGQCVSCMPGTYQDMEGQ
LSCTPCPSSDGLGLPGARNVSECGGQCSPGFFSADGFKPCQACPVGTYQPEPGRTGCFPC
GGGLLTKHEGTTSFQDCEAKVHCSPGHHYNTTTHRCIRCPVGTYQPEFGQNHCITCPGNT
STDFDGSTNVTHCKNQHCGGELGDYTGYIESPNYPGDYPANAECVWHIAPPPKRRILIVV
PEIFLPIEDECGDVLVMRKSASPTSITTYETCQTYERPIAFTSRSRKLWIQFKSNEGNSG
KGFQVPYVTYDEDYQQLIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYT
AQESKEMFPRSFIKLLRSKVSRFLRPYK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IBT9	0.920	0.915	0.000	994	0.773	0.769	A0A0R4IBT9.pdb.gz	A0A0R4IBT9_DANRE Signal peptide, CUB and EGF-like domain-containing protein 1 isoform 2 precursor OS=Danio rerio OX=7955 GN=im:7427863 PE=4 SV=1
2	AFDB:A0A2R8Q191	0.700	0.692	0.000	1002	0.659	0.650	A0A2R8Q191.pdb.gz
3	AFDB:M1FTT7	0.714	0.690	0.000	1024	0.771	0.744	M1FTT7.pdb.gz
4	AFDB:Q5G872	0.601	0.590	0.000	1010	0.656	0.642	Q5G872.pdb.gz	SCUB2_DANRE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Danio rerio OX=7955 GN=scube2 PE=2 SV=1
5	AFDB:Q66PY1	0.758	0.754	0.000	993	0.664	0.661	Q66PY1.pdb.gz	SCUB3_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Mus musculus OX=10090 GN=Scube3 PE=1 SV=1
6	AFDB:Q6NZL8	0.734	0.712	0.000	1018	0.919	0.892	Q6NZL8.pdb.gz	SCUB1_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Scube1 PE=2 SV=2
7	AFDB:Q8IWY4	1.000	1.000	0.000	988	1.000	1.000	Q8IWY4.pdb.gz	SCUB1_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCUBE1 PE=1 SV=3
8	AFDB:Q9JJS0	0.547	0.543	0.000	997	0.624	0.619	Q9JJS0.pdb.gz	SCUB2_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Mus musculus OX=10090 GN=Scube2 PE=1 SV=1
9	AFDB:Q9NQ36	0.531	0.525	0.000	999	0.652	0.645	Q9NQ36.pdb.gz	SCUB2_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SCUBE2 PE=1 SV=3
10	AFDB:Q86TI6	0.147	0.384	1.370E-47	347	0.291	0.830	Q86TI6.pdb.gz	Q86TI6_HUMAN SCUBE1 protein OS=Homo sapiens OX=9606 GN=SCUBE1 PE=2 SV=1
11	PDB:7q3nU	0.073	0.195	4.982E-6	292	0.050	0.168	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:7b01A	0.090	0.143	8.458E-4	588	0.022	0.037	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
13	PDB:4dxzA	0.070	0.440	6.248E-3	111	0.011	0.099	4dxzA.pdb.gz
14	PDB:3am2A	0.089	0.261	1.073E-2	286	0.006	0.021	3am2A.pdb.gz
15	PDB:7ff0A	0.070	0.227	2.547E-2	206	0.021	0.102	7ff0A.pdb.gz	Inhibitory mechanism of gold analogues against Pseudomonas global virulence factor regulator Vfr
16	PDB:1ft9A	0.066	0.226	2.688E-2	210	0.010	0.048	1ft9A.pdb.gz	Structure of the CO sensing transcription activator CooA.
17	PDB:6serA	0.054	0.138	2.995E-2	245	0.015	0.061	6serA.pdb.gz
18	PDB:4ryvA	0.065	0.258	7.112E-2	155	0.016	0.103	4ryvA.pdb.gz	Crystallographic and CD probing of ligand-induced conformational changes in a plant PR-10 protein.
19	PDB:2qimA	0.049	0.180	7.507E-2	157	0.019	0.121	2qimA.pdb.gz	Lupinus luteus pathogenesis-related protein as a reservoir for cytokinin.
20	PDB:5eiyB	0.066	0.093	7.507E-2	658	0.007	0.011	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IBT9	0.0	1555	994	0.774	0.770	A0A0R4IBT9_DANRE Signal peptide, CUB and EGF-like domain-containing protein 1 isoform 2 precursor OS=Danio rerio OX=7955 GN=im:7427863 PE=4 SV=1
2	F1R0I7	0.0	1329	995	0.655	0.650	F1R0I7_DANRE Scube3 OS=Danio rerio OX=7955 GN=scube3 PE=2 SV=3
3	Q5G872	0.0	1310	1010	0.651	0.637	SCUB2_DANRE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Danio rerio OX=7955 GN=scube2 PE=2 SV=1
4	Q66PY1	0.0	1359	993	0.661	0.658	SCUB3_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Mus musculus OX=10090 GN=Scube3 PE=1 SV=1
5	Q6NZL8	0.0	1881	1018	0.920	0.893	SCUB1_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Scube1 PE=2 SV=2
6	Q86TI6	0.0	566	347	0.284	0.810	Q86TI6_HUMAN SCUBE1 protein OS=Homo sapiens OX=9606 GN=SCUBE1 PE=2 SV=1
7	Q8IWY4	0.0	2032	988	1.000	1.000	SCUB1_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCUBE1 PE=1 SV=3
8	Q8IX30	0.0	1352	993	0.664	0.661	SCUB3_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SCUBE3 PE=1 SV=1
9	Q9JJS0	0.0	1263	997	0.632	0.626	SCUB2_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Mus musculus OX=10090 GN=Scube2 PE=1 SV=1
10	Q9NQ36	0.0	1300	999	0.653	0.646	SCUB2_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SCUBE2 PE=1 SV=3
11	M9PHP7	6.94e-63	235	1427	0.167	0.116	M9PHP7_DROME Faulty attraction, isoform F OS=Drosophila melanogaster OX=7227 GN=frac PE=4 SV=1
12	O00339	1.66e-62	232	956	0.143	0.147	MATN2_HUMAN Matrilin-2 OS=Homo sapiens OX=9606 GN=MATN2 PE=1 SV=4
13	O08746	3.57e-62	231	956	0.145	0.150	MATN2_MOUSE Matrilin-2 OS=Mus musculus OX=10090 GN=Matn2 PE=2 SV=2
14	Q80V70	9.18e-59	223	1572	0.142	0.089	MEGF6_MOUSE Multiple epidermal growth factor-like domains protein 6 OS=Mus musculus OX=10090 GN=Megf6 PE=2 SV=3
15	Q9VS89	4.61e-58	221	1618	0.166	0.101	Q9VS89_DROME FI18763p1 OS=Drosophila melanogaster OX=7227 GN=frac PE=2 SV=4
16	F1S0M0	9.72e-57	214	879	0.135	0.151	F1S0M0_PIG Matrilin 2 OS=Sus scrofa OX=9823 GN=MATN2 PE=1 SV=4
17	Q61555	5.48e-50	196	2907	0.151	0.051	FBN2_MOUSE Fibrillin-2 OS=Mus musculus OX=10090 GN=Fbn2 PE=1 SV=2
18	P35556	7.20e-50	195	2912	0.151	0.051	FBN2_HUMAN Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3
19	O75095	4.14e-48	189	1541	0.128	0.082	MEGF6_HUMAN Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens OX=9606 GN=MEGF6 PE=1 SV=4
20	P37889	3.39e-42	170	1221	0.134	0.108	FBLN2_MOUSE Fibulin-2 OS=Mus musculus OX=10090 GN=Fbln2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	8.3e-40	145.6	Complement Clr-like EGF-like
2	PF00431 CUB	3.8e-14	64.3	CUB domain
3	PF00008 EGF	1.3e-12	59.0	EGF-like domain
4	PF12947 EGF_3	1.6e-22	90.7	EGF domain
5	PF07645 EGF_CA	1.2e-22	91.1	Calcium-binding EGF domain
6	PF07699 Ephrin_rec_like	9.8e-29	110.2	Tyrosine-protein kinase ephrin type A/B receptor-like
7	PF14670 FXa_inhibition	4.9e-57	201.2	Coagulation Factor Xa inhibitory site
8	PF12661 hEGF	2	20.4	Human growth factor-like EGF

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354080

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274938	0.919	Signal peptide, CUB and EGF-like domain-containing protein 3
2	9606.ENSP00000306185	0.679	Anthrax toxin receptor 2
3	9606.ENSP00000307939	0.641	GRIP and coiled-coil domain-containing protein 2
4	9606.ENSP00000458715	0.630	Caspase recruitment domain-containing protein 14
5	9606.ENSP00000385035	0.599	Complement C1s subcomponent
6	9606.ENSP00000471457	0.557	Unconventional myosin-IXb
7	9606.ENSP00000438615	0.529	Complement C1r subcomponent
8	9606.ENSP00000322775	0.512	Inactive rhomboid protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.976	identical protein binding
GO:0043167	0.835	ion binding
GO:0046872	0.832	metal ion binding
GO:0005509	0.783	calcium ion binding
GO:0005102	0.403	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0023056	0.985	positive regulation of signaling
GO:0010647	0.985	positive regulation of cell communication
GO:0048583	0.981	regulation of response to stimulus
GO:0009987	0.924	cellular process
GO:0009967	0.924	positive regulation of signal transduction
GO:0045667	0.757	regulation of osteoblast differentiation
GO:0045669	0.754	positive regulation of osteoblast differentiation
GO:0032502	0.596	developmental process
GO:0048856	0.591	anatomical structure development
GO:0032501	0.446	multicellular organismal process
GO:0008589	0.413	regulation of smoothened signaling pathway
GO:0050896	0.377	response to stimulus
GO:0045880	0.345	positive regulation of smoothened signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005576	0.976	extracellular region
GO:0009986	0.811	cell surface
GO:0005622	0.746	intracellular anatomical structure
GO:0043226	0.745	organelle
GO:0005737	0.731	cytoplasm
GO:0043227	0.726	membrane-bounded organelle
GO:0043229	0.704	intracellular organelle
GO:0005615	0.612	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]