StarFunc result for job id Q8IWY9

User Input

>input (1227 residues)
MAAVLESLLREEVSVAAVVRWIARSTQGSEDNAGEAAALSSLRALRKEFVPFLLNFLREQ
SSRVLPQGPPTPAKTPGASAALPGRPGGPPRGSRGARSQLFPPTEAQSTAAEAPLARRGG
RRRGPGPARERGGRGLEEGVSGESLPGAGGRRLRGSGSPSRPSLTLSDPPNLSNLEEFPP
VGSVPPGPTGTKPSRRINPTPVSEERSLSKPKTCFTSPPISCVPSSQPSALDTSPWGLGL
PPGCRSLQEEREMLRKERSKQLQQSPTPTCPTPELGSPLPSRTGSLTDEPADPARVSSRQ
RLELVALVYSSCIAENLVPNLFLELFFVFQLLTARRMVTAKDSDPELSPAVLDSLESPLF
QSIHDCVFFAVQVLECHFQVLSNLDKGTLKLLAENERLLCFSPALQGRLRAAYEGSVAKV
SLVMPPSTQAVSFQPETDNRANFSSDRAFHTFKKQRDVFYEVLREWEDHHEEPGWDFEKG
LGSRIRAMMGQLSAACSHSHFVRLFQKQLLQMCQSPGGAGGTVLGEAPDVLSMLGADKLG
RLWRLQERLMAPQSSGGPCPPPTFPGCQGFFRDFILSASSFQFNQHLMDSLSLKIQELNG
LALPQHEPNDEDGESDVDWQGERKQFAVVLLSLRLLAKFLGFVAFLPYRGPEPPPTGELQ
DSILALRSQVPPVLDVRTLLQRGLQARRAVLTVPWLVEFLSFADHVVPLLEYYRDIFTLL
LRLHRSLVLSQESEGKMCFLNKLLLLAVLGWLFQIPTVPEDLFFLEEGPSYAFEVDTVAP
EHGLDNAPVVDQQLLYTCCPYIGELRKLLASWVSGSSGRSGGFMRKITPTTTTSLGAQPS
QTSQGLQAQLAQAFFHNQPPSLRRTVEFVAERIGSNCVKHIKATLVADLVRQAESLLQEQ
LVTQGEEGGDPAQLLEILCSQLCPHGAQALALGREFCQRKSPGAVRALLPEETPAAVLSS
AENIAVGLATEKACAWLSANITALIRREVKAAVSRTLRAQGPEPAARGERRGCSRACEHH
APLPSHLISEIKDVLSLAVGPRDPDEGVSPEHLEQLLGQLGQTLRCRQFLCPPAEQHLAK
CSVELASLLVADQIPILGPPAQYRLERGQARRLLHMLLSLWKEDFQGPVPLQLLLSPRNV
GLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFL
AEPHLPEPQLRACELVQPNRGTVLAQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CC12	0.773	0.766	0.000	1239	0.884	0.876	Q8CC12.pdb.gz	CDAN1_MOUSE Codanin-1 OS=Mus musculus OX=10090 GN=Cdan1 PE=1 SV=2
2	AFDB:Q8IWY9	1.000	1.000	0.000	1227	1.000	1.000	Q8IWY9.pdb.gz	CDAN1_HUMAN Codanin-1 OS=Homo sapiens OX=9606 GN=CDAN1 PE=1 SV=4
3	AFDB:Q8T626	0.381	0.377	1.853E-34	1240	0.219	0.217	Q8T626.pdb.gz	DLT_DROME Protein disks lost OS=Drosophila melanogaster OX=7227 GN=dlt PE=1 SV=2
4	AFDB:O22824	0.046	0.057	2.225E-3	894	0.104	0.143	O22824.pdb.gz	FH2_ARATH Formin-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=FH2 PE=3 SV=1
5	AFDB:Q8NB66	0.063	0.047	3.830E-3	2214	0.126	0.070	Q8NB66.pdb.gz	UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens OX=9606 GN=UNC13C PE=2 SV=3
6	AFDB:Q24367	0.065	0.073	4.138E-3	859	0.081	0.116	Q24367.pdb.gz	Q24367_DROME Inscuteable OS=Drosophila melanogaster OX=7227 GN=insc PE=1 SV=1
7	AFDB:Q99959	0.069	0.090	6.099E-3	881	0.081	0.114	Q99959.pdb.gz	PKP2_HUMAN Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2 PE=1 SV=2
8	AFDB:Q584T3	0.088	0.118	1.325E-2	775	0.091	0.145	Q584T3.pdb.gz	Q584T3_TRYB2 Mitochondrial oligo U binding protein TBRGG1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.600 PE=4 SV=1
9	PDB:6sytA	0.087	0.069	1.631E-2	1896	0.111	0.072	6sytA.pdb.gz	InsP6binding to PIKK kinases revealed by the cryo-EM structure of an SMG1-SMG8-SMG9 complex.
10	PDB:7qdrB	0.075	0.075	1.763E-2	1212	0.104	0.106	7qdrB.pdb.gz
11	PDB:4jlqA	0.075	0.097	2.140E-2	840	0.093	0.136	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
12	PDB:7r5j00	0.078	0.103	2.499E-2	756	0.080	0.130	7r5j00.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
13	AFDB:O35927	0.084	0.083	2.878E-2	1247	0.094	0.092	O35927.pdb.gz	CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1
14	PDB:3icqT	0.100	0.119	3.409E-2	949	0.098	0.126	3icqT.pdb.gz	Structures of the tRNA export factor in the nuclear and cytosolic states
15	AFDB:Q811T9	0.042	0.055	3.632E-2	852	0.112	0.162	Q811T9.pdb.gz	DISC1_MOUSE Disrupted in schizophrenia 1 homolog OS=Mus musculus OX=10090 GN=Disc1 PE=1 SV=2
16	PDB:7sukSP	0.078	0.053	4.302E-2	2234	0.083	0.046	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
17	PDB:7tzcA	0.071	0.036	4.833E-2	4404	0.117	0.033	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
18	PDB:6ahd1	0.080	0.087	5.024E-2	1048	0.101	0.118	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
19	PDB:7t3rA	0.089	0.058	6.591E-2	2130	0.098	0.056	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
20	PDB:7wooD	0.083	0.076	8.001E-2	1398	0.092	0.081	7wooD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CC12	0.0	2043	1239	0.887	0.878	CDAN1_MOUSE Codanin-1 OS=Mus musculus OX=10090 GN=Cdan1 PE=1 SV=2
2	Q8IWY9	0.0	2451	1227	1.000	1.000	CDAN1_HUMAN Codanin-1 OS=Homo sapiens OX=9606 GN=CDAN1 PE=1 SV=4
3	Q8T626	5.64e-49	193	1240	0.160	0.158	DLT_DROME Protein disks lost OS=Drosophila melanogaster OX=7227 GN=dlt PE=1 SV=2
4	Q93ZT6	0.46	37.4	780	0.036	0.056	IF4G1_ARATH Eukaryotic translation initiation factor isoform 4G-1 OS=Arabidopsis thaliana OX=3702 GN=EIF(ISO)4G1 PE=1 SV=1
5	Q7Z5P9	0.47	37.4	8384	0.045	0.007	MUC19_HUMAN Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3
6	Q9VPR5	2.3	35.0	1340	0.030	0.028	Q9VPR5_DROME Splicing factor 3b subunit 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Sf3b1 PE=1 SV=2
7	G5EEQ8	7.3	33.5	1322	0.046	0.042	G5EEQ8_CAEEL Splicing factor 3B subunit 1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sftb-1 PE=1 SV=1
8	Q63870	8.1	33.1	2944	0.031	0.013	CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus OX=10090 GN=Col7a1 PE=1 SV=3
9	Q02932	8.6	33.1	1032	0.020	0.023	KA120_YEAST Importin beta-like protein KAP120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KAP120 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15296 Codanin-1_C	2.7e-36	135.7	Codanin-1 C-terminus
2	PF19014 DUF5743	56	14.9	Family of unknown function (DUF5743)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348564

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263382	0.925	Histone chaperone ASF1B
2	9606.ENSP00000229595	0.858	Histone chaperone ASF1A
3	9606.ENSP00000455397	0.854	Uncharacterized protein C15orf41
4	9606.ENSP00000338844	0.816	Protein transport protein Sec23B
5	9606.ENSP00000371180	0.765	Cation channel sperm-associated protein 2
6	9606.ENSP00000401513	0.765	Stereocilin
7	9606.ENSP00000366354	0.736	Olfactory receptor 11A1
8	9606.ENSP00000280346	0.681	Dihydrolipoamide S-acetyltransferase
9	9606.ENSP00000346453	0.667	Importin-4
10	9606.ENSP00000368458	0.653	Proliferating cell nuclear antigen
11	9606.ENSP00000296755	0.645	Microtubule-associated protein 1B
12	9606.ENSP00000300215	0.642	Erythrocyte membrane protein band 4.2
13	9606.ENSP00000361095	0.595	Transmembrane protein 69
14	9606.ENSP00000347224	0.579	Vasculin-like protein 1
15	9606.ENSP00000309493	0.567	G-protein coupled receptor family C group 6 member A
16	9606.ENSP00000290607	0.559	StAR-related lipid transfer protein 9
17	9606.ENSP00000260363	0.547	Kinesin-like protein KIF23
18	9606.ENSP00000261483	0.538	Alpha-mannosidase 2
19	9606.ENSP00000248846	0.516	Gamma-tubulin complex component 6
20	9606.ENSP00000264834	0.515	Krueppel-like factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0016043	0.908	cellular component organization
GO:0051179	0.716	localization
GO:0051169	0.658	nuclear transport
GO:0006996	0.621	organelle organization
GO:0006325	0.474	chromatin organization
GO:0033036	0.342	macromolecule localization
GO:0006913	0.325	nucleocytoplasmic transport
GO:0051170	0.303	import into nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005634	1.000	nucleus
GO:0005737	0.977	cytoplasm
GO:0005886	0.975	plasma membrane
GO:0005829	0.974	cytosol
GO:0070013	0.368	intracellular organelle lumen
GO:0031981	0.337	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]