StarFunc result for job id Q8IWZ3

User Input

>input (2542 residues)
MLTDSGGGGTSFEEDLDSVAPRSAPAGASEPPPPGGVGLGIRTVRLFGEAGPASGVGSSG
GGGSGSGTGGGDAALDFKLAAAVLRTGGGGGASGSDEDEVSEVESFILDQEDLDNPVLKT
TSEIFLSSTAEGADLRTVDPETQARLEALLEAAGIGKLSTADGKAFADPEVLRRLTSSVS
CALDEAAAALTRMKAENSHNAGQVDTRSLAEACSDGDVNAVRKLLDEGRSVNEHTEEGES
LLCLACSAGYYELAQVLLAMHANVEDRGNKGDITPLMAASSGGYLDIVKLLLLHDADVNS
QSATGNTALTYACAGGFVDIVKVLLNEGANIEDHNENGHTPLMEAASAGHVEVARVLLDH
GAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEV
ARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAR
EGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADIELGCSTPLM
EASQEGHLELVKYLLASGANVHATTATGDTALTYACENGHTDVADVLLQAGADLEHESEG
GRTPLMKAARAGHLCTVQFLISKGANVNRATANNDHTVVSLACAGGHLAVVELLLAHGAD
PTHRLKDGSTMLIEAAKGGHTNVVSYLLDYPNNVLSVPTTDVSQLPPPSQDQSQVPRVPT
HTLAMVVPPQEPDRTSQENSPALLGVQKGTSKQKSSSLQVADQDLLPSFHPYQPLECIVE
ETEGKLNELGQRISAIEKAQLKSLELIQGEPLNKDKIEELKKNREEQVQKKKKILKELQK
VERQLQMKTQQQFTKEYLETKGQKDTVSLHQQCSHRGVFPEGEGDGSLPEDHFSELPQVD
TILFKDNDVDDEQQSPPSAEQIDFVPVQPLSSPQCNFSSDLGSNGTNSLELQKVSGNQQI
VGQPQIAITGHDQGLLVQEPDGLMVATPAQTLTDTLDDLIAAVSTRVPTGSNSSSQTTEC
LTPESCSQTTSNVASQSMPPVYPSVDIDAHTESNHDTALTLACAGGHEELVSVLIARDAK
IEHRDKKGFTPLILAATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDL
LLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMN
GHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTP
LMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIHRGAHIDV
RNKKGNTPLWLASNGGHFDVVQLLVQAGADVDAADNRKITPLMSAFRKGHVKVVQYLVKE
VNQFPSDIECMRYIATITDKELLKKCHQCVETIVKAKDQQAAEANKNASILLKELDLEKS
REESRKQALAAKREKRKEKRKKKKEEQKRKQEEDEENKPKENSELPEDEDEEENDEDVEQ
EVPIEPPSATTTTTIGISATSATFTNVFGKKRANVVTTPSTNRKNKKNKTKETPPTAHLI
LPEQHMSLAQQKADKNKINGEPRGGGAGGNSDSDNLDSTDCNSESSSGGKSQELNFVMDV
NSSKYPSLLLHSQEEKTSTATSKTQTRLEGEVTPNSLSTSYKTVSLPLSSPNIKLNLTSP
KRGQKREEGWKEVVRRSKKLSVPASVVSRIMGRGGCNITAIQDVTGAHIDVDKQKDKNGE
RMITIRGGTESTRYAVQLINALIQDPAKELEDLIPKNHIRTPASTKSIHANFSSGVGTTA
ASSKNAFPLGAPTLVTSQATTLSTFQPANKLNKNVPTNVRSSFPVSLPLAYPHPHFALLA
AQTMQQIRHPRLPMAQFGGTFSPSPNTWGPFPVRPVNPGNTNSSPKHNNTSRLPNQNGTV
LPSESAGLATASCPITVSSVVAASQQLCVTNTRTPSSVRKQLFACVPKTSPPATVISSVT
STCSSLPSVSSAPITSGQAPTTFLPASTSQAQLSSQKMESFSAVPPTKEKVSTQDQPMAN
LCTPSSTANSCSSSASNTPGAPETHPSSSPTPTSSNTQEEAQPSSVSDLSPMSMPFASNS
EPAPLTLTSPRMVAADNQDTSNLPQLAVPAPRVSHRMQPRGSFYSMVPNATIHQDPQSIF
VTNPVTLTPPQGPPAAVQLSSAVNIMNGSQMHINPANKSLPPTFGPATLFNHFSSLFDSS
QVPANQGWGDGPLSSRVATDASFTVQSAFLGNSVLGHLENMHPDNSKAPGFRPPSQRVST
SPVGLPSIDPSGSSPSSSSAPLASFSGIPGTRVFLQGPAPVGTPSFNRQHFSPHPWTSAS
NSSTSAPPTLGQPKGVSASQDRKIPPPIGTERLARIRQGGSVAQAPAGTSFVAPVGHSGI
WSFGVNAVSEGLSGWSQSVMGNHPMHQQLSDPSTFSQHQPMERDDSGMVAPSNIFHQPMA
SGFVDFSKGLPISMYGGTIIPSHPQLADVPGGPLFNGLHNPDPAWNPMIKVIQNSTECTD
AQQIWPGTWAPHIGNMHLKYVN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K916	0.543	0.530	0.000	2615	0.924	0.898	A0A0G2K916.pdb.gz	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
2	AFDB:E9QEX9	0.521	0.510	0.000	2607	0.721	0.703	E9QEX9.pdb.gz	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
3	AFDB:O75179	0.374	0.366	0.000	2603	0.617	0.602	O75179.pdb.gz	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
4	PDB:8cs9A	0.175	0.478	4.412E-38	796	0.102	0.325	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
5	AFDB:D3Z9Z0	0.189	0.271	3.040E-31	1707	0.092	0.137	D3Z9Z0.pdb.gz	D3Z9Z0_RAT Ankyrin 1 OS=Rattus norvegicus OX=10116 GN=Ank1 PE=1 SV=2
6	PDB:5vkqA	0.200	0.315	4.712E-29	1499	0.096	0.163	5vkqA.pdb.gz
7	AFDB:Q54KA7	0.179	0.439	6.523E-24	986	0.061	0.156	Q54KA7.pdb.gz	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
8	AFDB:G5EBJ4	0.172	0.636	4.434E-18	624	0.048	0.194	G5EBJ4.pdb.gz	G5EBJ4_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mlt-4 PE=1 SV=1
9	AFDB:A2A690	0.147	0.181	8.135E-18	1994	0.138	0.176	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
10	AFDB:Q96Q27	0.139	0.548	2.845E-17	587	0.048	0.208	Q96Q27.pdb.gz	ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens OX=9606 GN=ASB2 PE=1 SV=2
11	AFDB:Q9ERK0	0.140	0.424	7.153E-16	786	0.053	0.172	Q9ERK0.pdb.gz	RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Ripk4 PE=1 SV=2
12	AFDB:A0A0R4IA11	0.133	0.491	8.015E-16	563	0.049	0.222	A0A0R4IA11.pdb.gz
13	PDB:4oauC	0.107	0.369	2.137E-12	692	0.037	0.136	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:2dvwA	0.085	0.869	1.573E-9	229	0.027	0.297	2dvwA.pdb.gz
15	PDB:6v9hC	0.088	0.770	4.602E-8	270	0.028	0.263	6v9hC.pdb.gz
16	PDB:6aunA	0.101	0.383	5.563E-8	618	0.033	0.138	6aunA.pdb.gz
17	PDB:1wg0A	0.083	0.819	1.383E-7	243	0.021	0.222	1wg0A.pdb.gz
18	PDB:6pqpA	0.083	0.303	1.347E-6	615	0.031	0.130	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
19	PDB:6mwqA	0.058	0.293	3.102E-6	493	0.022	0.114	6mwqA.pdb.gz
20	PDB:6jd6B	0.060	0.769	3.222E-6	192	0.018	0.240	6jd6B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MQZ8	0.0	1656	866	0.327	0.961	A0A0A0MQZ8_HUMAN Ankyrin repeat and KH domain containing 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1
2	A0A0G2K916	0.0	4501	2615	0.916	0.891	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
3	A0A0R4IUB2	0.0	3319	2580	0.723	0.713	A0A0R4IUB2_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=2
4	E9QEX9	0.0	3308	2607	0.726	0.708	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
5	H0YM23	0.0	2727	2487	0.614	0.627	H0YM23_HUMAN Ankyrin repeat domain 17 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=1
6	O75179	0.0	2731	2603	0.614	0.599	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
7	Q8IWG5	0.0	1651	866	0.327	0.960	Q8IWG5_HUMAN ANKHD1 protein OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1
8	Q8IWZ3	0.0	5220	2542	1.000	1.000	ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1
9	Q99NH0	0.0	2687	2603	0.614	0.599	ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus OX=10090 GN=Ankrd17 PE=1 SV=2
10	Q9VCA8	0.0	652	4001	0.122	0.077	ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster OX=7227 GN=mask PE=1 SV=2
11	Q9ULJ7	1.39e-64	246	1429	0.070	0.125	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
12	A0A5F9ZHT8	7.99e-61	235	3891	0.068	0.044	A0A5F9ZHT8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
13	F1M5N3	8.76e-61	235	3966	0.068	0.044	F1M5N3_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4
14	A0A5F9ZHF7	8.96e-61	235	3862	0.068	0.045	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
15	A0A5F9ZI46	9.61e-61	235	3882	0.068	0.045	A0A5F9ZI46_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
16	A0A5F9ZHT4	1.09e-60	235	3870	0.068	0.045	A0A5F9ZHT4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZHR8	4.57e-60	233	3939	0.064	0.041	A0A5F9ZHR8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZHD2	4.61e-60	233	3936	0.064	0.041	A0A5F9ZHD2_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	Q01484	5.03e-60	233	3957	0.064	0.041	ANK2_HUMAN Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4
20	A0A5F9ZGZ5	5.56e-60	233	3874	0.064	0.042	A0A5F9ZGZ5_HUMAN Ankyrin 2 (Fragment) OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.5e-112	375.0	Ankyrin repeat
2	PF12796 Ank_2	3.2e-145	484.4	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.3e-98	321.7	Ankyrin repeat
4	PF13637 Ank_4	2.2e-116	390.1	Ankyrin repeats (many copies)
5	PF13857 Ank_5	3e-89	303.2	Ankyrin repeats (many copies)
6	PF00013 KH_1	1e-10	52.6	KH domain
7	PF04935 SURF6	9.6e+02	11.0	Surfeit locus protein 6

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354085

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308472	0.795	Eukaryotic translation initiation factor 4E-binding protein 3
2	9606.ENSP00000427661	0.764	Anion exchange protein 4
3	9606.ENSP00000257264	0.726	Transcobalamin-1
4	9606.ENSP00000415822	0.670	Ataxin-1-like
5	9606.ENSP00000339030	0.643	E3 ubiquitin-protein ligase ZFP91
6	9606.ENSP00000327509	0.627	SH3 and cysteine rich domain 2
7	9606.ENSP00000247665	0.611	14 kDa phosphohistidine phosphatase
8	9606.ENSP00000359411	0.595	KH homology domain-containing protein 1
9	9606.ENSP00000362314	0.595	Eukaryotic translation initiation factor 4E-binding protein 2
10	9606.ENSP00000328625	0.561	Negative regulator of reactive oxygen species
11	9606.ENSP00000451752	0.561	Spectrin beta chain, erythrocytic
12	9606.ENSP00000388638	0.542	Splicing factor 45
13	9606.ENSP00000444561	0.542	Transmembrane protein 14C
14	9606.ENSP00000278618	0.541	L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
15	9606.ENSP00000262519	0.540	Histone-lysine N-methyltransferase SETD1A
16	9606.ENSP00000257940	0.539	Zinc finger CCCH domain-containing protein 10
17	9606.ENSP00000442924	0.525	Histone-lysine N-methyltransferase SETD1B
18	9606.ENSP00000349259	0.523	Spectrin beta chain, non-erythrocytic 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.996	nucleic acid binding
GO:0003723	0.956	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.889	multicellular organismal process
GO:0065007	0.849	biological regulation
GO:0050789	0.766	regulation of biological process
GO:0003008	0.732	system process
GO:0009987	0.728	cellular process
GO:0003013	0.713	circulatory system process
GO:0050794	0.701	regulation of cellular process
GO:0003015	0.580	heart process
GO:0060047	0.415	heart contraction
GO:0050896	0.371	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0016020	0.996	membrane
GO:0005737	0.993	cytoplasm
GO:0005654	0.992	nucleoplasm
GO:0043228	0.895	non-membrane-bounded organelle
GO:0043232	0.891	intracellular non-membrane-bounded organelle
GO:0005829	0.890	cytosol
GO:0012505	0.849	endomembrane system
GO:0031090	0.587	organelle membrane
GO:0005886	0.359	plasma membrane
GO:0031967	0.352	organelle envelope
GO:0005635	0.324	nuclear envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]