StarFunc result for job id Q8IWZ6

User Input

>input (715 residues)
MDLILNRMDYLQVGVTSQKTMKLIPASRHRATQKVVIGDHDGVVMCFGMKKGEAAAVFKT
LPGPKIARLELGGVINTPQEKIFIAAASEIRGFTKRGKQFLSFETNLTESIKAMHISGSD
LFLSASYIYNHYCDCKDQHYYLSGDKINDVICLPVERLSRITPVLACQDRVLRVLQGSDV
MYAVEVPGPPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVRKWEIQNEKKRGG
ILCIDSFDIVGDGVKDLLVGRDDGMVEVYSFDNANEPVLRFDQMLSESVTSIQGGCVGKD
SYDEIVVSTYSGWVTGLTTEPIHKESGPGEELKINQEMQNKISSLRNELEHLQYKVLQER
ENYQQSSQSSKAKSAVPSFGINDKFTLNKDDASYSLILEVQTAIDNVLIQSDVPIDLLDV
DKNSAVVSFSSCDSESNDNFLLATYRCQADTTRLELKIRSIEGQYGTLQAYVTPRIQPKT
CQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGEC
VTFYFQNTFLDTQLESTYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEV
SVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEGNTNFLIPEYHCILEEADHLQEEY
KKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEILDSYDQNALISFFDAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1Q6W8	0.993	0.993	0.000	715	0.762	0.762	F1Q6W8.pdb.gz
2	AFDB:Q8IWZ6	1.000	1.000	0.000	715	1.000	1.000	Q8IWZ6.pdb.gz	BBS7_HUMAN Bardet-Biedl syndrome 7 protein OS=Homo sapiens OX=9606 GN=BBS7 PE=1 SV=2
3	AFDB:Q9XW70	0.943	0.935	1.301E-74	721	0.327	0.325	Q9XW70.pdb.gz	BBS7_CAEEL Bardet-Biedl syndrome 7 protein homolog OS=Caenorhabditis elegans OX=6239 GN=osm-12 PE=1 SV=1
4	AFDB:Q57WA0	0.890	0.849	3.985E-55	751	0.208	0.198	Q57WA0.pdb.gz	Q57WA0_TRYB2 FG-GAP repeat protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.950 PE=4 SV=1
5	AFDB:Q584V4	0.356	0.347	1.521E-31	736	0.145	0.141	Q584V4.pdb.gz	Q584V4_TRYB2 FG-GAP repeat protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.130 PE=4 SV=1
6	AFDB:Q9BXC9	0.351	0.348	8.523E-31	721	0.148	0.147	Q9BXC9.pdb.gz	BBS2_HUMAN Bardet-Biedl syndrome 2 protein OS=Homo sapiens OX=9606 GN=BBS2 PE=1 SV=2
7	AFDB:Q98SP7	0.354	0.354	1.823E-30	715	0.143	0.143	Q98SP7.pdb.gz	BBS2_DANRE Bardet-Biedl syndrome 2 protein homolog OS=Danio rerio OX=7955 GN=bbs2 PE=2 SV=1
8	AFDB:Q19640	0.336	0.337	4.052E-27	714	0.133	0.133	Q19640.pdb.gz	BBS2_CAEEL Bardet-Biedl syndrome 2 protein homolog OS=Caenorhabditis elegans OX=6239 GN=bbs-2 PE=2 SV=2
9	AFDB:Q3SYG4	0.353	0.290	3.803E-24	887	0.109	0.088	Q3SYG4.pdb.gz	PTHB1_HUMAN Protein PTHB1 OS=Homo sapiens OX=9606 GN=BBS9 PE=1 SV=1
10	AFDB:O01514	0.356	0.344	4.900E-24	744	0.123	0.118	O01514.pdb.gz	PTHB1_CAEEL Protein pthb1 homolog OS=Caenorhabditis elegans OX=6239 GN=bbs-9 PE=1 SV=5
11	PDB:6xt9I	0.342	0.320	7.995E-19	767	0.120	0.112	6xt9I.pdb.gz
12	PDB:6xt9A	0.339	0.417	1.526E-15	567	0.095	0.120	6xt9A.pdb.gz
13	PDB:7kzpQ	0.314	0.300	2.289E-15	754	0.113	0.107	7kzpQ.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
14	PDB:7kzpB	0.229	0.233	2.131E-14	701	0.143	0.146	7kzpB.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
15	PDB:7ajtUO	0.338	0.478	2.195E-13	493	0.069	0.099	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:7mq8LT	0.291	0.243	1.088E-11	869	0.112	0.092	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7mq8LR	0.244	0.228	2.577E-11	773	0.131	0.122	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:6bk8D	0.359	0.681	3.865E-11	359	0.056	0.111	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
19	PDB:5k1aF	0.337	0.395	5.799E-11	600	0.070	0.083	5k1aF.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
20	PDB:5hxbY	0.333	0.230	6.751E-11	1080	0.083	0.055	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08C18	0.0	1164	715	0.764	0.764	Q08C18_DANRE Bardet-Biedl syndrome 7 protein homolog OS=Danio rerio OX=7955 GN=zgc:153772 PE=2 SV=1
2	Q8IWZ6	0.0	1481	715	1.000	1.000	BBS7_HUMAN Bardet-Biedl syndrome 7 protein OS=Homo sapiens OX=9606 GN=BBS7 PE=1 SV=2
3	Q8K2G4	0.0	1347	715	0.917	0.917	BBS7_MOUSE Bardet-Biedl syndrome 7 protein homolog OS=Mus musculus OX=10090 GN=Bbs7 PE=1 SV=1
4	Q9XW70	1.00e-130	405	721	0.330	0.327	BBS7_CAEEL Bardet-Biedl syndrome 7 protein homolog OS=Caenorhabditis elegans OX=6239 GN=osm-12 PE=1 SV=1
5	Q57WA0	1.90e-42	167	751	0.206	0.196	Q57WA0_TRYB2 FG-GAP repeat protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.950 PE=4 SV=1
6	Q9BXC9	0.003	43.5	721	0.077	0.076	BBS2_HUMAN Bardet-Biedl syndrome 2 protein OS=Homo sapiens OX=9606 GN=BBS2 PE=1 SV=2
7	Q9CWF6	0.008	42.0	721	0.073	0.072	BBS2_MOUSE Bardet-Biedl syndrome 2 protein homolog OS=Mus musculus OX=10090 GN=Bbs2 PE=1 SV=1
8	Q98SP7	0.011	41.6	715	0.071	0.071	BBS2_DANRE Bardet-Biedl syndrome 2 protein homolog OS=Danio rerio OX=7955 GN=bbs2 PE=2 SV=1
9	Q9PTD5	0.15	37.4	335	0.031	0.066	MTFR1_CHICK Mitochondrial fission regulator 1 OS=Gallus gallus OX=9031 GN=MTFR1 PE=1 SV=2
10	F4KIH8	0.23	37.4	1377	0.032	0.017	F4KIH8_ARATH Transducin/WD40 repeat-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=TWD40-2 PE=1 SV=1
11	Q15746	0.24	37.4	1914	0.032	0.012	MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4
12	Q8TED0	1.1	35.0	518	0.038	0.052	UTP15_HUMAN U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens OX=9606 GN=UTP15 PE=1 SV=3
13	H0Y8P4	1.3	34.7	545	0.038	0.050	H0Y8P4_HUMAN U3 small nucleolar RNA-associated protein 15 homolog (Fragment) OS=Homo sapiens OX=9606 GN=UTP15 PE=1 SV=1
14	Q9ULV0	1.3	35.0	1848	0.027	0.010	MYO5B_HUMAN Unconventional myosin-Vb OS=Homo sapiens OX=9606 GN=MYO5B PE=1 SV=3
15	Q6PDN3	1.4	35.0	1941	0.032	0.012	MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3
16	Q08622	4.6	33.1	556	0.024	0.031	GEP3_YEAST Genetic interactor of prohibitins 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GEP3 PE=1 SV=1
17	Q969X6	5.9	32.7	686	0.041	0.042	UTP4_HUMAN U3 small nucleolar RNA-associated protein 4 homolog OS=Homo sapiens OX=9606 GN=UTP4 PE=1 SV=1
18	H3BSH7	8.6	32.0	700	0.041	0.041	H3BSH7_HUMAN UTP4 small subunit processome component (Fragment) OS=Homo sapiens OX=9606 GN=UTP4 PE=1 SV=1
19	H3BPD7	9.7	30.8	148	0.025	0.122	H3BPD7_HUMAN UTP4 small subunit processome component (Fragment) OS=Homo sapiens OX=9606 GN=UTP4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14783 BBS2_Mid	1.6	20.2	Ciliary BBSome complex subunit 2, middle region
2	PF14282 FlxA	32	16.0	FlxA-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264499

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242067	0.999	Protein PTHB1
2	9606.ENSP00000245157	0.999	Bardet-Biedl syndrome 2 protein
3	9606.ENSP00000268057	0.999	Bardet-Biedl syndrome 4 protein
4	9606.ENSP00000295240	0.999	Bardet-Biedl syndrome 5 protein
5	9606.ENSP00000317469	0.999	Bardet-Biedl syndrome 1 protein
6	9606.ENSP00000438273	0.998	Bardet-Biedl syndrome 12 protein
7	9606.ENSP00000482306	0.997	Tetratricopeptide repeat protein 8
8	9606.ENSP00000376946	0.996	Bardet-Biedl syndrome 10 protein
9	9606.ENSP00000296135	0.986	Leucine zipper transcription factor-like protein 1
10	9606.ENSP00000433157	0.985	BBSome interacting protein 1
11	9606.ENSP00000246062	0.982	McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin
12	9606.ENSP00000299300	0.959	T-complex protein 1 subunit beta
13	9606.ENSP00000317334	0.959	T-complex protein 1 subunit alpha
14	9606.ENSP00000286788	0.947	T-complex protein 1 subunit theta
15	9606.ENSP00000337722	0.940	ADP-ribosylation factor-like protein 6
16	9606.ENSP00000295688	0.927	T-complex protein 1 subunit gamma
17	9606.ENSP00000377958	0.927	T-complex protein 1 subunit delta
18	9606.ENSP00000280326	0.904	T-complex protein 1 subunit epsilon
19	9606.ENSP00000447300	0.901	Rab-3A-interacting protein
20	9606.ENSP00000323580	0.888	Intraflagellar transport protein 88 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061629	1.000	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0048518	0.807	positive regulation of biological process
GO:0019222	0.738	regulation of metabolic process
GO:0051179	0.725	localization
GO:0051171	0.705	regulation of nitrogen compound metabolic process
GO:0051641	0.698	cellular localization
GO:0048522	0.694	positive regulation of cellular process
GO:0060255	0.650	regulation of macromolecule metabolic process
GO:0080090	0.643	regulation of primary metabolic process
GO:0031323	0.636	regulation of cellular metabolic process
GO:0071840	0.632	cellular component organization or biogenesis
GO:0016043	0.611	cellular component organization
GO:0009893	0.602	positive regulation of metabolic process
GO:0009894	0.528	regulation of catabolic process
GO:0032501	0.526	multicellular organismal process
GO:0051173	0.491	positive regulation of nitrogen compound metabolic process
GO:0044085	0.449	cellular component biogenesis
GO:0010604	0.419	positive regulation of macromolecule metabolic process
GO:1903050	0.415	regulation of proteolysis involved in protein catabolic process
GO:0032502	0.413	developmental process
GO:0022607	0.409	cellular component assembly
GO:0042176	0.394	regulation of protein catabolic process
GO:0048856	0.393	anatomical structure development
GO:0044782	0.373	cilium organization
GO:0006810	0.359	transport
GO:0031329	0.321	regulation of cellular catabolic process
GO:0060271	0.318	cilium assembly
GO:0010556	0.307	regulation of macromolecule biosynthetic process
GO:0031326	0.307	regulation of cellular biosynthetic process
GO:0019219	0.307	regulation of nucleobase-containing compound metabolic process
GO:0008104	0.300	protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0034464	0.999	BBSome
GO:0005813	0.999	centrosome
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0005829	0.961	cytosol
GO:0005634	0.957	nucleus
GO:0005886	0.943	plasma membrane
GO:0031090	0.844	organelle membrane
GO:0098588	0.712	bounding membrane of organelle
GO:0098590	0.677	plasma membrane region
GO:0031253	0.647	cell projection membrane
GO:0060170	0.632	ciliary membrane
GO:0097730	0.516	non-motile cilium
GO:0043005	0.508	neuron projection
GO:0036064	0.489	ciliary basal body
GO:0097731	0.383	9+0 non-motile cilium
GO:0070013	0.371	intracellular organelle lumen
GO:0099568	0.369	cytoplasmic region
GO:0097733	0.362	photoreceptor cell cilium
GO:0031981	0.328	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]