StarFunc result for job id Q8IX03

User Input

>input (1113 residues)
MPRPELPLPEGWEEARDFDGKVYYIDHTNRTTSWIDPRDRYTKPLTFADCISDELPLGWE
EAYDPQVGDYFIDHNTKTTQIEDPRVQWRREQEHMLKDYLVVAQEALSAQKEIYQVKQQR
LELAQQEYQQLHAVWEHKLGSQVSLVSGSSSSSKYDPEILKAEIATAKSRVNKLKREMVH
LQHELQFKERGFQTLKKIDKKMSDAQGSYKLDEAQAVLRETKAIKKAITCGEKEKQDLIK
SLAMLKDGFRTDRGSHSDLWSSSSSLESSSFPLPKQYLDVSSQTDISGSFGINSNNQLAE
KVRLRLRYEEAKRRIANLKIQLAKLDSEAWPGVLDSERDRLILINEKEELLKEMRFISPR
KWTQGEVEQLEMARKRLEKDLQAARDTQSKALTERLKLNSKRNQLVRELEEATRQVATLH
SQLKSLSSSMQSLSSGSSPGSLTSSRGSLVASSLDSSTSASFTDLYYDPFEQLDSELQSK
VEFLLLEGATGFRPSGCITTIHEDEVAKTQKAEGGGRLQALRSLSGTPKSMTSLSPRSSL
SSPSPPCSPLMADPLLAGDAFLNSLEFEDPELSATLCELSLGNSAQERYRLEEPGTEGKQ
LGQAVNTAQGCGLKVACVSAAVSDESVAGDSGVYEASVQRLGASEAAAFDSDESEAVGAT
RIQIALKYDEKNKQFAILIIQLSNLSALLQQQDQKVNIRVAVLPCSESTTCLFRTRPLDA
SDTLVFNEVFWVSMSYPALHQKTLRVDVCTTDRSHLEECLGGAQISLAEVCRSGERSTRW
YNLLSYKYLKKQSRELKPVGVMAPASGPASTDAVSALLEQTAVELEKRQEGRSSTQTLED
SWRYEETSENEAVAEEEEEEVEEEEGEEDVFTEKASPDMDGYPALKVDKETNTETPAPSP
TVVRPKDRRVGTPSQGPFLRGSTIIRSKTFSPGPQSQYVCRLNRSDSDSSTLSKKPPFVR
NSLERRSVRMKRPSSVKSLRSERLIRTSLDLELDLQATRTWHSQLTQEISVLKELKEQLE
QAKSHGEKELPQWLREDERFRLLLRMLEKRQMDRAEHKGELQTDKMMRAAAKDVHRLRGQ
SCKEPPEVQSFREKMAFFTRPRMNIPALSADDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IX03	1.000	1.000	0.000	1113	1.000	1.000	Q8IX03.pdb.gz	KIBRA_HUMAN Protein KIBRA OS=Homo sapiens OX=9606 GN=WWC1 PE=1 SV=1
2	AFDB:E9QGC4	0.425	0.425	3.926E-85	1112	0.578	0.578	E9QGC4.pdb.gz	E9QGC4_DANRE Protein KIBRA OS=Danio rerio OX=7955 GN=wwc1 PE=4 SV=2
3	AFDB:Q6AWC2	0.429	0.404	2.807E-79	1192	0.522	0.487	Q6AWC2.pdb.gz	WWC2_HUMAN Protein WWC2 OS=Homo sapiens OX=9606 GN=WWC2 PE=1 SV=2
4	AFDB:Q9VFG8	0.467	0.407	7.746E-55	1288	0.322	0.278	Q9VFG8.pdb.gz	KIBRA_DROME Protein kibra OS=Drosophila melanogaster OX=7227 GN=kibra PE=1 SV=2
5	AFDB:F1R9U1	0.110	0.280	7.663E-9	422	0.049	0.130	F1R9U1.pdb.gz	F1R9U1_DANRE Double C2-like domain-containing protein alpha OS=Danio rerio OX=7955 GN=si:dkey-93n13.3 PE=4 SV=2
6	AFDB:Q86UR5	0.118	0.081	3.006E-8	1692	0.097	0.064	Q86UR5.pdb.gz	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
7	PDB:3pfqA	0.106	0.216	5.004E-7	523	0.020	0.042	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
8	AFDB:Q99N80	0.108	0.204	8.145E-7	567	0.060	0.118	Q99N80.pdb.gz	SYTL1_MOUSE Synaptotagmin-like protein 1 OS=Mus musculus OX=10090 GN=Sytl1 PE=1 SV=2
9	AFDB:M9PJH7	0.092	0.188	9.835E-7	520	0.072	0.154	M9PJH7.pdb.gz	M9PJH7_DROME Rabphilin, isoform C OS=Drosophila melanogaster OX=7227 GN=Rph PE=4 SV=1
10	AFDB:P70169	0.119	0.292	1.815E-6	412	0.046	0.124	P70169.pdb.gz	DOC2B_MOUSE Double C2-like domain-containing protein beta OS=Mus musculus OX=10090 GN=Doc2b PE=1 SV=2
11	AFDB:M9PE32	0.110	0.094	9.904E-6	1314	0.082	0.069	M9PE32.pdb.gz	M9PE32_DROME Fife, isoform D OS=Drosophila melanogaster OX=7227 GN=Fife PE=1 SV=1
12	PDB:1cjyA	0.075	0.128	2.537E-3	633	0.012	0.021	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:5a50A	0.065	0.395	3.063E-3	165	0.019	0.127	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
14	PDB:5ixcA	0.074	0.119	3.529E-3	684	0.014	0.023	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:7lq1A	0.077	0.089	5.393E-3	950	0.021	0.024	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
16	PDB:5izrC	0.072	0.118	9.953E-3	659	0.015	0.026	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	PDB:5iz5B	0.077	0.111	1.202E-2	746	0.017	0.025	5iz5B.pdb.gz
18	PDB:5a52A	0.064	0.408	1.321E-2	154	0.015	0.110	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:5iz5A	0.073	0.104	1.595E-2	757	0.018	0.026	5iz5A.pdb.gz
20	PDB:5itdA	0.068	0.075	2.116E-2	995	0.019	0.021	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QGC4	0.0	1086	1112	0.582	0.583	E9QGC4_DANRE Protein KIBRA OS=Danio rerio OX=7955 GN=wwc1 PE=4 SV=2
2	F1M6U0	0.0	1836	1108	0.911	0.915	F1M6U0_RAT WW and C2 domain containing 1 OS=Rattus norvegicus OX=10116 GN=Wwc1 PE=1 SV=3
3	Q5SXA9	0.0	1855	1104	0.911	0.918	KIBRA_MOUSE Protein KIBRA OS=Mus musculus OX=10090 GN=Wwc1 PE=1 SV=1
4	Q6AWC2	0.0	931	1192	0.531	0.496	WWC2_HUMAN Protein WWC2 OS=Homo sapiens OX=9606 GN=WWC2 PE=1 SV=2
5	Q8IX03	0.0	2277	1113	1.000	1.000	KIBRA_HUMAN Protein KIBRA OS=Homo sapiens OX=9606 GN=WWC1 PE=1 SV=1
6	Q9ULE0	4.45e-110	371	1092	0.196	0.200	WWC3_HUMAN Protein WWC3 OS=Homo sapiens OX=9606 GN=WWC3 PE=1 SV=3
7	Q9VFG8	6.70e-93	326	1288	0.180	0.155	KIBRA_DROME Protein kibra OS=Drosophila melanogaster OX=7227 GN=kibra PE=1 SV=2
8	Q5F488	8.81e-17	88.6	1128	0.034	0.034	MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus OX=9031 GN=MAGI3 PE=2 SV=1
9	O88382	1.33e-16	87.8	1277	0.037	0.032	MAGI2_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Magi2 PE=1 SV=1
10	Q9JK71	1.55e-16	87.8	1470	0.034	0.026	MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Magi3 PE=1 SV=2
11	Q86UL8	1.73e-16	87.8	1455	0.037	0.028	MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAGI2 PE=1 SV=3
12	Q9WVQ1	1.82e-16	87.4	1275	0.037	0.032	MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Mus musculus OX=10090 GN=Magi2 PE=1 SV=2
13	Q5TCQ9	1.99e-16	87.4	1481	0.034	0.026	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
14	Q9EQJ9	2.01e-16	87.4	1476	0.034	0.026	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2
15	F1Q897	3.36e-16	86.7	1503	0.035	0.026	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
16	H7C4U7	5.72e-16	85.9	1131	0.038	0.037	H7C4U7_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
17	H7C5T8	5.79e-16	85.9	1014	0.038	0.041	H7C5T8_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
18	H7C535	6.57e-16	85.5	1136	0.038	0.037	H7C535_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
19	A0A8I3NPD4	7.39e-16	85.5	1398	0.038	0.030	A0A8I3NPD4_CANLF Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Canis lupus familiaris OX=9615 GN=MAGI1 PE=1 SV=1
20	Q9W2L2	8.12e-16	85.5	1202	0.033	0.031	Q9W2L2_DROME LD27118p OS=Drosophila melanogaster OX=7227 GN=Magi PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03131 bZIP_Maf	43	16.0	bZIP Maf transcription factor
2	PF00168 C2	1.1	21.0	C2 domain
3	PF00397 WW	4.4e-15	66.8	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000029906

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000008365	0.966	Uncharacterized protein
2	9598.ENSPTRP00000010750	0.966	FERM domain containing 6
3	9598.ENSPTRP00000044030	0.963	Neurofibromin 2 (merlin)
4	9598.ENSPTRP00000031907	0.951	LATS, large tumor suppressor, homolog 1
5	9598.ENSPTRP00000003322	0.906	Protein tyrosine phosphatase, non-receptor type 14
6	9598.ENSPTRP00000038209	0.904	Uncharacterized protein
7	9598.ENSPTRP00000009705	0.877	LATS, large tumor suppressor, homolog 2
8	9598.ENSPTRP00000001393	0.793	Uncharacterized protein
9	9598.ENSPTRP00000014376	0.731	KIAA0513
10	9598.ENSPTRP00000026413	0.726	Sorting nexin 4
11	9598.ENSPTRP00000052777	0.722	Uncharacterized protein
12	9598.ENSPTRP00000047044	0.714	Synaptopodin
13	9598.ENSPTRP00000041760	0.711	Exocyst complex component 1
14	9598.ENSPTRP00000024729	0.697	Protein interacting with PRKCA 1
15	9598.ENSPTRP00000030612	0.680	Epithelial discoidin domain-containing receptor 1
16	9598.ENSPTRP00000007067	0.678	Integrator complex subunit 4
17	9598.ENSPTRP00000018116	0.675	Notch 3
18	9598.ENSPTRP00000032127	0.675	Uncharacterized protein
19	9598.ENSPTRP00000025763	0.655	Dystroglycan 1 (Dystrophin-associated glycoprotein 1)
20	9598.ENSPTRP00000052545	0.649	Protein tyrosine phosphatase, non-receptor type 21

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0060090	1.000	molecular adaptor activity
GO:0019900	1.000	kinase binding
GO:0140110	0.996	transcription regulator activity
GO:0003712	0.993	transcription coregulator activity
GO:0003713	0.940	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050789	0.989	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0048519	0.962	negative regulation of biological process
GO:0060255	0.934	regulation of macromolecule metabolic process
GO:0016477	0.933	cell migration
GO:0031323	0.930	regulation of cellular metabolic process
GO:0051171	0.918	regulation of nitrogen compound metabolic process
GO:0080090	0.915	regulation of primary metabolic process
GO:0023051	0.898	regulation of signaling
GO:0048523	0.890	negative regulation of cellular process
GO:0050793	0.884	regulation of developmental process
GO:0009966	0.878	regulation of signal transduction
GO:0010468	0.860	regulation of gene expression
GO:0048518	0.786	positive regulation of biological process
GO:0019219	0.729	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.725	regulation of macromolecule biosynthetic process
GO:0031326	0.725	regulation of cellular biosynthetic process
GO:0051252	0.722	regulation of RNA metabolic process
GO:0048522	0.697	positive regulation of cellular process
GO:1902531	0.682	regulation of intracellular signal transduction
GO:0009892	0.660	negative regulation of metabolic process
GO:0048585	0.640	negative regulation of response to stimulus
GO:0006355	0.638	regulation of DNA-templated transcription
GO:0051239	0.622	regulation of multicellular organismal process
GO:0051172	0.621	negative regulation of nitrogen compound metabolic process
GO:0031324	0.621	negative regulation of cellular metabolic process
GO:0009968	0.618	negative regulation of signal transduction
GO:0010605	0.596	negative regulation of macromolecule metabolic process
GO:0040008	0.496	regulation of growth
GO:0048638	0.455	regulation of developmental growth
GO:0046620	0.439	regulation of organ growth
GO:0006357	0.344	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.991	cytosol
GO:0016020	0.987	membrane
GO:0005886	0.980	plasma membrane
GO:0032991	0.975	protein-containing complex
GO:0043227	0.975	membrane-bounded organelle
GO:0043231	0.961	intracellular membrane-bounded organelle
GO:0005634	0.895	nucleus
GO:0070013	0.581	intracellular organelle lumen
GO:0031981	0.553	nuclear lumen
GO:0005654	0.417	nucleoplasm
GO:0120025	0.416	plasma membrane bounded cell projection
GO:0031252	0.328	cell leading edge
GO:0098590	0.300	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]