StarFunc result for job id Q8IX07

User Input

>input (1006 residues)
MSRRKQSNPRQIKRSLGDMEAREEVQLVGASHMEQKATAPEAPSPPSADVNSPPPLPPPT
SPGGPKELEGQEPEPRPTEEEPGSPWSGPDELEPVVQDGQRRIRARLSLATGLSWGPFHG
SVQTRASSPRQAEPSPALTLLLVDEACWLRTLPQALTEAEANTEIHRKDDALWCRVTKPV
PAGGLLSVLLTAEPHSTPGHPVKKEPAEPTCPAPAHDLQLLPQQAGMASILATAVINKDV
FPCKDCGIWYRSERNLQAHLLYYCASRQGTGSPAAAATDEKPKETYPNERVCPFPQCRKS
CPSASSLEIHMRSHSGERPFVCLICLSAFTTKANCERHLKVHTDTLSGVCHSCGFISTTR
DILYSHLVTNHMVCQPGSKGEIYSPGAGHPATKLPPDSLGSFQQQHTALQGPLASADLGL
APTPSPGLDRKALAEATNGEARAEPLAQNGGSSEPPAAPRSIKVEAVEEPEAAPILGPGE
PGPQAPSRTPSPRSPAPARVKAELSSPTPGSSPVPGELGLAGALFLPQYVFGPDAAPPAS
EILAKMSELVHSRLQQGAGAGAGGAQTGLFPGAPKGATCFECEITFSNVNNYYVHKRLYC
SGRRAPEDAPAARRPKAPPGPARAPPGQPAEPDAPRSSPGPGAREEGAGGAATPEDGAGG
RGSEGSQSPGSSVDDAEDDPSRTLCEACNIRFSRHETYTVHKRYYCASRHDPPPRRPAAP
PGPPGPAAPPAPSPAAPVRTRRRRKLYELHAAGAPPPPPPGHAPAPESPRPGSGSGSGPG
LAPARSPGPAADGPIDLSKKPRRPLPGAPAPALADYHECTACRVSFHSLEAYLAHKKYSC
PAAPPPGALGLPAAACPYCPPNGPVRGDLLEHFRLAHGLLLGAPLAGPGVEARTPADRGP
SPAPAPAASPQPGSRGPRDGLGPEPQEPPPGPPPSPAAAPEAVPPPPAPPSYSDKGVQTP
SKGTPAPLPNGNHRYCRLCNIKFSSLSTFIAHKKYYCSSHAAEHVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IX07	1.000	1.000	0.000	1006	1.000	1.000	Q8IX07.pdb.gz	FOG1_HUMAN Zinc finger protein ZFPM1 OS=Homo sapiens OX=9606 GN=ZFPM1 PE=1 SV=2
2	AFDB:Q9HAZ2	0.092	0.075	1.869E-14	1276	0.205	0.161	Q9HAZ2.pdb.gz	PRD16_HUMAN Histone-lysine N-methyltransferase PRDM16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=3
3	AFDB:A2A935	0.079	0.064	2.504E-13	1275	0.198	0.156	A2A935.pdb.gz	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
4	AFDB:A0A2R8QDL5	0.085	0.073	4.629E-9	1191	0.176	0.149	A0A2R8QDL5.pdb.gz
5	AFDB:Q9NSC2	0.058	0.046	1.169E-8	1324	0.201	0.153	Q9NSC2.pdb.gz	SALL1_HUMAN Sal-like protein 1 OS=Homo sapiens OX=9606 GN=SALL1 PE=1 SV=2
6	AFDB:P08151	0.061	0.056	1.302E-7	1106	0.209	0.190	P08151.pdb.gz	GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens OX=9606 GN=GLI1 PE=1 SV=1
7	AFDB:A2A7B5	0.098	0.061	1.667E-7	1709	0.161	0.095	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
8	AFDB:Q92618	0.068	0.063	2.733E-7	1163	0.174	0.150	Q92618.pdb.gz	ZN516_HUMAN Zinc finger protein 516 OS=Homo sapiens OX=9606 GN=ZNF516 PE=1 SV=1
9	AFDB:Q5EXX3	0.057	0.049	6.490E-7	1203	0.155	0.130	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
10	AFDB:Q13029	0.082	0.052	7.812E-7	1718	0.171	0.100	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
11	PDB:2g46A	0.077	0.522	4.837E-3	119	0.015	0.126	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
12	PDB:3w5kB	0.046	0.248	8.972E-3	110	0.032	0.291	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
13	PDB:3qxyA	0.048	0.105	3.716E-2	420	0.010	0.024	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
14	PDB:5h6zA	0.080	0.531	3.953E-2	123	0.009	0.073	5h6zA.pdb.gz
15	PDB:7td5A	0.070	0.135	7.801E-2	497	0.011	0.022	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
16	PDB:7td5F	0.070	0.150	1.279E-1	447	0.012	0.027	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
17	PDB:6t1rA	0.039	0.130	2.524E-1	166	0.013	0.078	6t1rA.pdb.gz
18	PDB:5hynA	0.070	0.117	3.037E-1	581	0.011	0.019	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
19	PDB:6wkrC	0.073	0.117	4.137E-1	606	0.010	0.017	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
20	PDB:7zdzA	0.031	0.069	4.401E-1	325	0.027	0.083	7zdzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35615	0.0	1258	995	0.730	0.738	FOG1_MOUSE Zinc finger protein ZFPM1 OS=Mus musculus OX=10090 GN=Zfpm1 PE=1 SV=1
2	Q8IX07	0.0	1980	1006	1.000	1.000	FOG1_HUMAN Zinc finger protein ZFPM1 OS=Homo sapiens OX=9606 GN=ZFPM1 PE=1 SV=2
3	F1R4T3	2.49e-108	365	1142	0.315	0.278	F1R4T3_DANRE Zinc finger protein ZFPM2 isoform X1 OS=Danio rerio OX=7955 GN=FOG-A PE=4 SV=1
4	Q2QKJ9	6.14e-108	364	1141	0.316	0.279	Q2QKJ9_DANRE Fog2a OS=Danio rerio OX=7955 GN=fog2a PE=2 SV=1
5	D4A0R1	1.59e-99	341	1151	0.303	0.265	D4A0R1_RAT Zinc finger protein, multitype 2 OS=Rattus norvegicus OX=10116 GN=Zfpm2 PE=4 SV=4
6	Q8WW38	2.46e-98	337	1151	0.260	0.228	FOG2_HUMAN Zinc finger protein ZFPM2 OS=Homo sapiens OX=9606 GN=ZFPM2 PE=1 SV=3
7	Q8CCH7	5.30e-98	337	1151	0.263	0.230	FOG2_MOUSE Zinc finger protein ZFPM2 OS=Mus musculus OX=10090 GN=Zfpm2 PE=1 SV=2
8	Q2QKJ8	9.53e-96	329	1093	0.278	0.256	Q2QKJ8_DANRE Fog2b OS=Danio rerio OX=7955 GN=fog2b PE=2 SV=1
9	E7ET52	4.72e-84	295	1019	0.218	0.215	E7ET52_HUMAN Zinc finger protein, FOG family member 2 OS=Homo sapiens OX=9606 GN=ZFPM2 PE=1 SV=1
10	P60622	8.54e-49	174	224	0.104	0.469	FOG1_DANRE Zinc finger protein ZFPM1 (Fragment) OS=Danio rerio OX=7955 GN=zfpm1 PE=1 SV=1
11	B2GM63	1.19e-45	181	1018	0.144	0.142	B2GM63_DANRE Neural friend of GATA-B OS=Danio rerio OX=7955 GN=FOG-B PE=2 SV=1
12	Q9VY72	2.34e-12	73.9	1553	0.039	0.025	Q9VY72_DROME Maternal gene required for meiosis, isoform H OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=4
13	O08900	1.40e-11	70.5	507	0.034	0.067	IKZF3_MOUSE Zinc finger protein Aiolos OS=Mus musculus OX=10090 GN=Ikzf3 PE=1 SV=2
14	Q9UKT9	3.04e-11	69.3	509	0.034	0.067	IKZF3_HUMAN Zinc finger protein Aiolos OS=Homo sapiens OX=9606 GN=IKZF3 PE=1 SV=2
15	Q8BX22	1.79e-10	67.8	1067	0.040	0.037	SALL4_MOUSE Sal-like protein 4 OS=Mus musculus OX=10090 GN=Sall4 PE=1 SV=2
16	Q9JHX2	3.76e-10	65.5	398	0.033	0.083	SP5_MOUSE Transcription factor Sp5 OS=Mus musculus OX=10090 GN=Sp5 PE=2 SV=1
17	Q9UJQ4	4.39e-10	66.2	1053	0.036	0.034	SALL4_HUMAN Sal-like protein 4 OS=Homo sapiens OX=9606 GN=SALL4 PE=1 SV=1
18	Q7T2W1	4.41e-10	65.1	357	0.038	0.106	Q7T2W1_DANRE Sp5 transcription factor-like OS=Danio rerio OX=7955 GN=spr2 PE=2 SV=1
19	Q9VPQ6	4.68e-10	66.2	1191	0.109	0.092	USH_DROME Zinc finger protein ush OS=Drosophila melanogaster OX=7227 GN=ush PE=1 SV=2
20	Q3SY56	9.41e-10	63.9	376	0.032	0.085	SP6_HUMAN Transcription factor Sp6 OS=Homo sapiens OX=9606 GN=SP6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00320 GATA	5.4e+02	11.6	GATA zinc finger
2	PF00096 zf-C2H2	5e-06	37.8	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	0.027	26.3	C2H2-type zinc finger
4	PF12171 zf-C2H2_jaz	8e-07	40.4	Zinc-finger double-stranded RNA-binding
5	PF13465 zf-H2C2_2	0.64	21.8	Zinc-finger double domain
6	PF12874 zf-met	0.00019	32.9	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326630

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365858	0.999	Erythroid transcription factor
2	9606.ENSP00000362592	0.998	Histone-binding protein RBBP4
3	9606.ENSP00000349508	0.968	Chromodomain-helicase-DNA-binding protein 4
4	9606.ENSP00000345681	0.961	Endothelial transcription factor GATA-2
5	9606.ENSP00000362649	0.954	Histone deacetylase 1
6	9606.ENSP00000329380	0.944	Platelet glycoprotein Ib alpha chain
7	9606.ENSP00000262407	0.943	Integrin alpha-IIb
8	9606.ENSP00000369424	0.936	Histone-binding protein RBBP7
9	9606.ENSP00000430432	0.934	Histone deacetylase 2
10	9606.ENSP00000369716	0.931	Chromodomain-helicase-DNA-binding protein 3
11	9606.ENSP00000278823	0.928	Metastasis-associated protein MTA2
12	9606.ENSP00000353463	0.927	Transcriptional repressor p66-alpha
13	9606.ENSP00000357644	0.927	Transcriptional repressor p66-beta
14	9606.ENSP00000412302	0.905	Methyl-CpG-binding domain protein 3
15	9606.ENSP00000399797	0.903	Putative helicase MOV-10
16	9606.ENSP00000362287	0.902	Protein argonaute-3
17	9606.ENSP00000362300	0.902	Protein argonaute-1
18	9606.ENSP00000362306	0.902	Protein argonaute-4
19	9606.ENSP00000260356	0.901	Thrombospondin-1
20	9606.ENSP00000336783	0.900	Trinucleotide repeat-containing gene 6C protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003714	1.000	transcription corepressor activity
GO:0061629	1.000	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003676	0.556	nucleic acid binding
GO:0003677	0.553	DNA binding
GO:0043565	0.543	sequence-specific DNA binding
GO:1990837	0.531	sequence-specific double-stranded DNA binding
GO:0003700	0.523	DNA-binding transcription factor activity
GO:0000976	0.513	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0010468	0.994	regulation of gene expression
GO:0031326	0.990	regulation of cellular biosynthetic process
GO:0010556	0.989	regulation of macromolecule biosynthetic process
GO:0051252	0.986	regulation of RNA metabolic process
GO:0009987	0.984	cellular process
GO:2001141	0.983	regulation of RNA biosynthetic process
GO:0032502	0.977	developmental process
GO:0048519	0.967	negative regulation of biological process
GO:0006355	0.960	regulation of DNA-templated transcription
GO:0032501	0.954	multicellular organismal process
GO:0048518	0.952	positive regulation of biological process
GO:0048523	0.937	negative regulation of cellular process
GO:0010604	0.936	positive regulation of macromolecule metabolic process
GO:0031327	0.906	negative regulation of cellular biosynthetic process
GO:0010558	0.902	negative regulation of macromolecule biosynthetic process
GO:0006357	0.891	regulation of transcription by RNA polymerase II
GO:0051253	0.887	negative regulation of RNA metabolic process
GO:0045892	0.872	negative regulation of DNA-templated transcription
GO:0048856	0.863	anatomical structure development
GO:0000122	0.838	negative regulation of transcription by RNA polymerase II
GO:0050896	0.816	response to stimulus
GO:0051239	0.670	regulation of multicellular organismal process
GO:0048522	0.628	positive regulation of cellular process
GO:0030154	0.505	cell differentiation
GO:0051173	0.474	positive regulation of nitrogen compound metabolic process
GO:0031325	0.465	positive regulation of cellular metabolic process
GO:0045935	0.449	positive regulation of nucleobase-containing compound metabolic process
GO:0050793	0.440	regulation of developmental process
GO:0051254	0.435	positive regulation of RNA metabolic process
GO:0031328	0.400	positive regulation of cellular biosynthetic process
GO:0009653	0.380	anatomical structure morphogenesis
GO:0048468	0.377	cell development
GO:0045595	0.375	regulation of cell differentiation
GO:0030097	0.345	hemopoiesis
GO:2000026	0.337	regulation of multicellular organismal development
GO:0007275	0.332	multicellular organism development
GO:0051241	0.322	negative regulation of multicellular organismal process
GO:0010557	0.320	positive regulation of macromolecule biosynthetic process
GO:0045893	0.314	positive regulation of DNA-templated transcription
GO:0051240	0.304	positive regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.997	protein-containing complex
GO:0005667	0.948	transcription regulator complex
GO:0017053	0.507	transcription repressor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]