StarFunc result for job id Q8IX12

User Input

>input (1150 residues)
MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPAN
YQLTQTAALQQQAAAAAAALQQQYSQPQQALYSVQQQLQQPQQTLLTQPAVALPTSLSLS
TPQPTAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLSAVKGKTP
QVGDRVLVEATYNPNMPFKWNAQRIQTLPNQNQSQTQPLLKTPPAVLQPIAPQTTFGVQT
QPQPQSLLQAQISAASITPLLQTQPQPLLQQPQQKAGLLQPPVRIVSQPQPARRLDPPSR
FSGRNDRGDQVPNRKDDRSRERERERRRSRERSPQRKRSRERSPRRERERSPRRVRRVVP
RYTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFY
VMHREVESLEKNMAILDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQELRDGFQH
PARLVKFLVGMKGKDEAMAIGGHWSPSLDGPDPEKDPSVLIKTAIRCCKALTGIDLSVCT
QWYRFAEIRYHRPEETHKGRTVPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEK
LQGERKEADGEQDEEEKDDGEAKEISTPTHWSKLDPKTMKVNDLRKELESRALSSKGLKS
QLIARLTKQLKVEEQKEEQKELEKSEKEEDEDDDRKSEDDKEEEERKRQEEIERQRRERR
YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQR
DFGVRIYKSLLSLPEKEDKKEKDKKSKKDERKDKKEERDDETDEPKPKRRKSGDDKDKKE
DRDERKKEDKRKDDSKDDDETEEDNNQDEYDPMEAEEAEDEEDDRDEEEMTKRDDKRDIN
RYCKERPSKDKEKEKTQMITINRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQ
VKKLLNKVVLRESCFYRKLTDTSKDEENHEESESLQEDMLGNRLLLPTPTVKQESKDVEE
NVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLS
GELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNEDKD
QKSKENGASV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IX12	1.000	1.000	0.000	1150	1.000	1.000	Q8IX12.pdb.gz	CCAR1_HUMAN Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1 PE=1 SV=2
2	AFDB:Q8N163	0.330	0.407	1.701E-57	923	0.285	0.355	Q8N163.pdb.gz	CCAR2_HUMAN Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=2
3	AFDB:Q86A78	0.286	0.259	6.276E-26	1282	0.160	0.144	Q86A78.pdb.gz	Q86A78_DICDI Calcium-binding EF-hand domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1124 PE=4 SV=1
4	PDB:3aqqA	0.052	0.529	2.791E-3	99	0.016	0.182	3aqqA.pdb.gz
5	PDB:3mdgB	0.074	0.334	1.423E-2	210	0.022	0.119	3mdgB.pdb.gz	Structural basis of UGUA recognition by the Nudix protein CFI(m)25 and implications for a regulatory role in mRNA 3' processing.
6	PDB:1zeqX	0.051	0.544	4.213E-2	84	0.011	0.155	1zeqX.pdb.gz
7	PDB:3h0gG	0.048	0.260	6.867E-2	170	0.011	0.076	3h0gG.pdb.gz	Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
8	PDB:3kf6B	0.056	0.489	8.532E-2	105	0.006	0.067	3kf6B.pdb.gz
9	PDB:2c35B	0.048	0.269	9.008E-2	171	0.010	0.064	2c35B.pdb.gz
10	PDB:4dayB	0.051	0.425	9.510E-2	113	0.010	0.106	4dayB.pdb.gz	Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
11	PDB:1zo1W	0.045	0.459	1.060E-1	71	0.013	0.211	1zo1W.pdb.gz
12	PDB:4c3hG	0.039	0.136	1.391E-1	259	0.007	0.031	4c3hG.pdb.gz	Crystal Structure of the 14-Subunit RNA Polymerase I
13	PDB:6d6qI	0.045	0.248	1.550E-1	183	0.010	0.060	6d6qI.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
14	AFDB:L0N7N1	0.059	0.045	1.856E-1	1674	0.064	0.044	L0N7N1.pdb.gz	KIF14_MOUSE Kinesin-like protein KIF14 OS=Mus musculus OX=10090 GN=Kif14 PE=1 SV=1
15	AFDB:Q9QYM2	0.038	0.033	3.122	972	0.061	0.072	Q9QYM2.pdb.gz	PARG_RAT Poly(ADP-ribose) glycohydrolase OS=Rattus norvegicus OX=10116 GN=Parg PE=1 SV=1
16	AFDB:D3ZE20	0.039	0.047	3.675	827	0.064	0.089	D3ZE20.pdb.gz	D3ZE20_RAT Nuclear factor of activated T-cells 1 OS=Rattus norvegicus OX=10116 GN=Nfatc1 PE=4 SV=4
17	AFDB:A7MD48	0.031	0.052	4.324	611	0.058	0.110	A7MD48.pdb.gz	SRRM4_HUMAN Serine/arginine repetitive matrix protein 4 OS=Homo sapiens OX=9606 GN=SRRM4 PE=1 SV=2
18	AFDB:O02776	0.025	0.028	4.566	977	0.053	0.062	O02776.pdb.gz	PARG_BOVIN Poly(ADP-ribose) glycohydrolase OS=Bos taurus OX=9913 GN=PARG PE=1 SV=1
19	AFDB:D4A0I8	0.043	0.049	4.820	931	0.071	0.088	D4A0I8.pdb.gz	D4A0I8_RAT Nuclear factor of activated T-cells 2 OS=Rattus norvegicus OX=10116 GN=Nfatc2 PE=1 SV=1
20	AFDB:Q5XJE5	0.041	0.059	4.820	667	0.057	0.099	Q5XJE5.pdb.gz	LEO1_MOUSE RNA polymerase-associated protein LEO1 OS=Mus musculus OX=10090 GN=Leo1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CH18	0.0	1799	1146	0.941	0.944	CCAR1_MOUSE Cell division cycle and apoptosis regulator protein 1 OS=Mus musculus OX=10090 GN=Ccar1 PE=1 SV=1
2	Q8IX12	0.0	2363	1150	1.000	1.000	CCAR1_HUMAN Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1 PE=1 SV=2
3	Q8VDP4	2.27e-92	319	922	0.167	0.208	CCAR2_MOUSE Cell cycle and apoptosis regulator protein 2 OS=Mus musculus OX=10090 GN=Ccar2 PE=1 SV=2
4	Q8N163	5.77e-91	315	923	0.161	0.200	CCAR2_HUMAN Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=2
5	H0YB24	1.64e-37	152	615	0.066	0.124	H0YB24_HUMAN Cell cycle and apoptosis regulator 2 (Fragment) OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=1
6	G3V119	1.28e-36	149	598	0.106	0.204	G3V119_HUMAN Cell cycle and apoptosis regulator 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=1
7	E2PSM9	4.43e-25	110	365	0.059	0.186	E2PSM9_HUMAN cDNA FLJ12599 fis, clone NT2RM4001410 OS=Homo sapiens OX=9606 PE=1 SV=1
8	G5EBS4	2.23e-23	107	509	0.039	0.088	G5EBS4_CAEEL DBC1/CARP1 catalytically inactive NUDIX hydrolase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccar-1 PE=1 SV=1
9	A0A0S4XR43	2.74e-23	109	1215	0.069	0.065	A0A0S4XR43_CAEEL SAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccar-1 PE=1 SV=1
10	H2KMJ3	7.93e-23	107	659	0.039	0.068	H2KMJ3_CAEEL DBC1/CARP1 catalytically inactive NUDIX hydrolase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccar-1 PE=1 SV=1
11	F4IS91	9.16e-19	95.1	1340	0.079	0.068	RSA1_ARATH Protein SHORT ROOT IN SALT MEDIUM 1 OS=Arabidopsis thaliana OX=3702 GN=RSA1 PE=1 SV=1
12	Q86A78	1.99e-15	84.3	1282	0.044	0.040	Q86A78_DICDI Calcium-binding EF-hand domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1124 PE=4 SV=1
13	Q9BTB7	0.002	42.0	122	0.017	0.164	Q9BTB7_HUMAN Heterogeneous nuclear ribonucleoprotein U-like 1 OS=Homo sapiens OX=9606 GN=HNRPUL1 PE=1 SV=1
14	Q54CF8	0.10	39.3	3071	0.027	0.010	Q54CF8_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293012 PE=4 SV=1
15	Q8VDM6	0.16	38.5	859	0.015	0.020	HNRL1_MOUSE Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Mus musculus OX=10090 GN=Hnrnpul1 PE=1 SV=1
16	A1ZBB4	0.23	38.1	1271	0.015	0.013	A1ZBB4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=hnRNP U PE=1 SV=1
17	A8E6M1	0.23	38.1	1271	0.015	0.013	A8E6M1_DROME GH01011p OS=Drosophila melanogaster OX=7227 GN=CG5477 PE=1 SV=1
18	E1JGL8	0.23	38.1	1272	0.015	0.013	E1JGL8_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Dmel\CG30122 PE=1 SV=1
19	Q12019	0.39	37.4	4910	0.030	0.007	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
20	F1QBY1	1.7	35.4	2876	0.025	0.010	NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio OX=7955 GN=nipblb PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19257 BURAN	5.5e-17	73.6	BURAN domain
2	PF14443 DBC1	5.8e-47	170.1	DBC1
3	PF19256 LAIKA	3.3e-26	102.2	LAIKA domain
4	PF14444 S1-like	1.9e-31	119.2	S1-like
5	PF02037 SAP	6.3e-06	37.1	SAP domain
6	PF14552 Tautomerase_2	1.6e+02	13.8	Tautomerase enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265872

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316032	0.859	Nuclear pore complex protein Nup98-Nup96
2	9606.ENSP00000324422	0.808	Zyxin
3	9606.ENSP00000370695	0.788	Exocyst complex component 1
4	9606.ENSP00000222005	0.767	Hsp90 co-chaperone Cdc37
5	9606.ENSP00000328848	0.745	RNA-binding protein 10
6	9606.ENSP00000202816	0.732	ESF1 homolog
7	9606.ENSP00000307863	0.731	Splicing factor U2AF 65 kDa subunit
8	9606.ENSP00000483825	0.716	NF-kappa-B essential modulator
9	9606.ENSP00000354791	0.712	Dynactin subunit 1
10	9606.ENSP00000298596	0.708	Storkhead-box protein 1
11	9606.ENSP00000439856	0.707	Calcium homeostasis endoplasmic reticulum protein
12	9606.ENSP00000344456	0.694	Catenin beta-1
13	9606.ENSP00000365439	0.693	Heterogeneous nuclear ribonucleoprotein K
14	9606.ENSP00000376534	0.686	Bromodomain adjacent to zinc finger domain protein 2B
15	9606.ENSP00000384040	0.686	Coiled-coil domain containing 85A
16	9606.ENSP00000338191	0.673	Beta-2-syntrophin
17	9606.ENSP00000318861	0.672	Splicing factor 3B subunit 2
18	9606.ENSP00000355510	0.671	WD repeat-containing protein 64
19	9606.ENSP00000216106	0.659	HMG domain-containing protein 4
20	9606.ENSP00000256442	0.656	G2/mitotic-specific cyclin-B1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:0003723	0.999	RNA binding
GO:0003677	0.997	DNA binding
GO:0003714	0.990	transcription corepressor activity
GO:0030374	0.990	nuclear receptor coactivator activity
GO:0000978	0.989	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.994	regulation of cellular process
GO:0048522	0.958	positive regulation of cellular process
GO:0042127	0.948	regulation of cell population proliferation
GO:0042981	0.943	regulation of apoptotic process
GO:0010942	0.927	positive regulation of cell death
GO:0040012	0.920	regulation of locomotion
GO:0008284	0.877	positive regulation of cell population proliferation
GO:0043068	0.875	positive regulation of programmed cell death
GO:2000145	0.839	regulation of cell motility
GO:0040017	0.818	positive regulation of locomotion
GO:0030334	0.802	regulation of cell migration
GO:2000147	0.792	positive regulation of cell motility
GO:0009987	0.650	cellular process
GO:0043065	0.506	positive regulation of apoptotic process
GO:0019222	0.432	regulation of metabolic process
GO:0030335	0.425	positive regulation of cell migration
GO:0008152	0.421	metabolic process
GO:0031323	0.414	regulation of cellular metabolic process
GO:0051171	0.408	regulation of nitrogen compound metabolic process
GO:0080090	0.407	regulation of primary metabolic process
GO:0060255	0.402	regulation of macromolecule metabolic process
GO:0071704	0.340	organic substance metabolic process
GO:0006807	0.339	nitrogen compound metabolic process
GO:0019219	0.316	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0012505	0.997	endomembrane system
GO:0005635	0.990	nuclear envelope
GO:0031970	0.988	organelle envelope lumen
GO:0005641	0.983	nuclear envelope lumen
GO:0032991	0.943	protein-containing complex
GO:0005829	0.932	cytosol
GO:0016020	0.503	membrane
GO:0043232	0.344	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]