StarFunc result for job id Q8IX15

User Input

>input (550 residues)
MVRGWEPPPGLDCAISEGHKSEGTMPPNKEASGLSSSPAGLICLPPISEELQLVWTQAAQ
TSELDSNEHLLKTFSYFPYPSLADIALLCLRYGLQMEKVKTWFMAQRLRCGISWSSEEIE
ETRARVVYRRDQLHFKSLLSFTHHAGRPPEEVPPPPVPAPEQVGIGIGPPTLSKPTQTKG
LKVEPEEPSQMPPLPQSHQKLKESLMTPGSGAFPYQSDFWQHLQSSGLSKEQAGRGPNQS
HGIGTASWNHSTTVPQPQARDKPPPIALIASSCKEESASSVTPSSSSTSSSFQVLANGAT
AASKPLQPLGCVPQSVSPSEQALPPHLEPAWPQGLRHNSVPGRVGPTEYLSPDMQRQRKT
KRKTKEQLAILKSFFLQCQWARREDYQKLEQITGLPRPEIIQWFGDTRYALKHGQLKWFR
DNAVPGAPSFQDPAIPTPPPSTRSLNERAETPPLPIPPPPPDIQPLERYWAAHQQLRETD
IPQLSQASRLSTQQVLDWFDSRLPQPAEVVVCLDEEEEEEEEELPEDDEEEEEEEEEDDD
DDDDDVIIQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IX15	0.999	0.999	5.691E-73	550	1.000	1.000	Q8IX15.pdb.gz	HOMEZ_HUMAN Homeobox and leucine zipper protein Homez OS=Homo sapiens OX=9606 GN=HOMEZ PE=1 SV=2
2	AFDB:A0A669KB72	0.344	0.418	3.753E-56	439	0.798	1.000	A0A669KB72.pdb.gz	A0A669KB72_HUMAN Homeobox and leucine zipper encoding OS=Homo sapiens OX=9606 GN=HOMEZ PE=1 SV=1
3	AFDB:Q80W88	0.481	0.487	5.371E-54	542	0.758	0.769	Q80W88.pdb.gz	HOMEZ_MOUSE Homeobox and leucine zipper protein Homez OS=Mus musculus OX=10090 GN=Homez PE=1 SV=2
4	AFDB:Q9W268	0.104	0.063	4.855E-4	1024	0.120	0.064	Q9W268.pdb.gz	Q9W268_DROME Defective proventriculus, isoform A OS=Drosophila melanogaster OX=7227 GN=dve PE=2 SV=1
5	AFDB:P97503	0.122	0.194	1.728E-3	333	0.116	0.192	P97503.pdb.gz	NKX32_MOUSE Homeobox protein Nkx-3.2 OS=Mus musculus OX=10090 GN=Nkx3-2 PE=1 SV=2
6	AFDB:F1Q4R9	0.110	0.187	3.261E-3	253	0.078	0.170	F1Q4R9.pdb.gz	MEOX1_DANRE Homeobox protein MOX-1 OS=Danio rerio OX=7955 GN=meox1 PE=2 SV=1
7	AFDB:B2RYB5	0.126	0.208	4.352E-3	313	0.089	0.157	B2RYB5.pdb.gz	B2RYB5_RAT Hoxa10 protein OS=Rattus norvegicus OX=10116 GN=Hoxa10 PE=2 SV=1
8	AFDB:Q9GZZ0	0.117	0.191	4.352E-3	328	0.100	0.168	Q9GZZ0.pdb.gz	HXD1_HUMAN Homeobox protein Hox-D1 OS=Homo sapiens OX=9606 GN=HOXD1 PE=2 SV=1
9	AFDB:P06798	0.101	0.186	5.174E-3	285	0.096	0.186	P06798.pdb.gz	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
10	AFDB:A0A2R8Q2A2	0.118	0.211	1.034E-2	282	0.087	0.170	A0A2R8Q2A2.pdb.gz
11	PDB:4egcA	0.090	0.092	2.399E-1	539	0.015	0.015	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:5ds9B	0.058	0.242	1.355	98	0.013	0.071	5ds9B.pdb.gz	DNA Sequence Determinants Controlling Affinity, Stability and Shape of DNA Complexes Bound by the Nucleoid Protein Fis.
13	PDB:7mq8LL	0.056	0.060	3.222	510	0.055	0.059	7mq8LL.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:5znxA	0.067	0.299	3.616	95	0.015	0.084	5znxA.pdb.gz
15	PDB:6gejS	0.059	0.129	4.058	208	0.044	0.115	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
16	PDB:8escE	0.062	0.073	4.058	440	0.027	0.034	8escE.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
17	PDB:5nr5A	0.072	0.270	4.555	113	0.027	0.133	5nr5A.pdb.gz
18	PDB:7mbyR	0.037	0.063	4.825	283	0.018	0.035	7mbyR.pdb.gz	Structures of the human cholecystokinin 1 (CCK1) receptor bound to Gs and Gq mimetic proteins provide insight into mechanisms of G protein selectivity.
19	PDB:7vdvX	0.063	0.120	5.112	252	0.033	0.071	7vdvX.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
20	PDB:5xqmA	0.048	0.169	5.416	90	0.013	0.078	5xqmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80W88	0.0	690	542	0.700	0.710	HOMEZ_MOUSE Homeobox and leucine zipper protein Homez OS=Mus musculus OX=10090 GN=Homez PE=1 SV=2
2	Q8IX15	0.0	1110	550	1.000	1.000	HOMEZ_HUMAN Homeobox and leucine zipper protein Homez OS=Homo sapiens OX=9606 GN=HOMEZ PE=1 SV=2
3	U3KPW8	7.21e-179	508	324	0.460	0.781	U3KPW8_HUMAN Homeobox and leucine zipper encoding (Fragment) OS=Homo sapiens OX=9606 GN=HOMEZ PE=1 SV=3
4	A0A669KB72	2.91e-141	417	439	0.404	0.506	A0A669KB72_HUMAN Homeobox and leucine zipper encoding OS=Homo sapiens OX=9606 GN=HOMEZ PE=1 SV=1
5	Q80Z36	6.45e-23	105	951	0.095	0.055	ZHX3_RAT Zinc fingers and homeoboxes protein 3 OS=Rattus norvegicus OX=10116 GN=Zhx3 PE=1 SV=2
6	Q9H4I2	9.99e-23	105	956	0.093	0.053	ZHX3_HUMAN Zinc fingers and homeoboxes protein 3 OS=Homo sapiens OX=9606 GN=ZHX3 PE=1 SV=3
7	Q8C0Q2	1.32e-22	104	951	0.093	0.054	ZHX3_MOUSE Zinc fingers and homeoboxes protein 3 OS=Mus musculus OX=10090 GN=Zhx3 PE=1 SV=2
8	H0Y6F5	1.43e-22	104	678	0.093	0.075	H0Y6F5_HUMAN Zinc fingers and homeoboxes 3 (Fragment) OS=Homo sapiens OX=9606 GN=ZHX3 PE=1 SV=1
9	Q9UKY1	3.31e-16	84.3	873	0.096	0.061	ZHX1_HUMAN Zinc fingers and homeoboxes protein 1 OS=Homo sapiens OX=9606 GN=ZHX1 PE=1 SV=1
10	P70121	2.18e-15	82.0	873	0.104	0.065	ZHX1_MOUSE Zinc fingers and homeoboxes protein 1 OS=Mus musculus OX=10090 GN=Zhx1 PE=1 SV=2
11	Q8R515	7.20e-15	80.1	873	0.104	0.065	ZHX1_RAT Zinc fingers and homeoboxes protein 1 OS=Rattus norvegicus OX=10116 GN=Zhx1 PE=1 SV=1
12	Q9Y6X8	1.92e-09	62.8	837	0.049	0.032	ZHX2_HUMAN Zinc fingers and homeoboxes protein 2 OS=Homo sapiens OX=9606 GN=ZHX2 PE=1 SV=1
13	Q8C0C0	2.17e-09	62.8	836	0.049	0.032	ZHX2_MOUSE Zinc fingers and homeoboxes protein 2 OS=Mus musculus OX=10090 GN=Zhx2 PE=1 SV=1
14	Q61329	0.040	39.7	3726	0.084	0.012	ZFHX3_MOUSE Zinc finger homeobox protein 3 OS=Mus musculus OX=10090 GN=Zfhx3 PE=1 SV=1
15	F1M4Q6	0.041	39.3	3730	0.084	0.012	F1M4Q6_RAT Zinc finger homeobox 3 OS=Rattus norvegicus OX=10116 GN=Zfhx3 PE=4 SV=3
16	Q15911	0.044	39.3	3703	0.084	0.012	ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens OX=9606 GN=ZFHX3 PE=1 SV=2
17	Q01826	0.058	38.9	763	0.049	0.035	SATB1_HUMAN DNA-binding protein SATB1 OS=Homo sapiens OX=9606 GN=SATB1 PE=1 SV=1
18	Q60611	0.062	38.5	764	0.049	0.035	SATB1_MOUSE DNA-binding protein SATB1 OS=Mus musculus OX=10090 GN=Satb1 PE=1 SV=2
19	P48002	0.098	37.7	383	0.029	0.042	KNAT5_ARATH Homeobox protein knotted-1-like 5 OS=Arabidopsis thaliana OX=3702 GN=KNAT5 PE=1 SV=2
20	Q9U1R1	0.15	36.6	234	0.033	0.077	CEH51_CAEEL Homeobox protein ceh-51 OS=Caenorhabditis elegans OX=6239 GN=ceh-51 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	3.6e-05	34.9	Homeobox KN domain
2	PF00046 Homeodomain	1.1e-10	52.5	Homeodomain
3	PF11569 Homez	1.6e-23	93.4	Homeodomain leucine-zipper encoding, Homez

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350049

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000040584	0.771	Homeobox protein Hox-C8
2	9606.ENSP00000356064	0.674	Tubby-related protein 4
3	9606.ENSP00000297977	0.517	Highly divergent homeobox
4	9606.ENSP00000264808	0.510	PR domain zinc finger protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.945	nucleic acid binding
GO:0003677	0.935	DNA binding
GO:0043565	0.814	sequence-specific DNA binding
GO:0003690	0.679	double-stranded DNA binding
GO:1990837	0.655	sequence-specific double-stranded DNA binding
GO:0140110	0.526	transcription regulator activity
GO:0003700	0.522	DNA-binding transcription factor activity
GO:0000981	0.366	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010558	0.986	negative regulation of macromolecule biosynthetic process
GO:0031327	0.986	negative regulation of cellular biosynthetic process
GO:0045934	0.986	negative regulation of nucleobase-containing compound metabolic process
GO:1903507	0.957	negative regulation of nucleic acid-templated transcription
GO:0045892	0.954	negative regulation of DNA-templated transcription
GO:0006357	0.819	regulation of transcription by RNA polymerase II
GO:0009987	0.590	cellular process
GO:0000122	0.477	negative regulation of transcription by RNA polymerase II
GO:0008152	0.344	metabolic process
GO:0071704	0.331	organic substance metabolic process
GO:0044238	0.311	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005829	0.997	cytosol
GO:0005730	0.985	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]