StarFunc result for job id Q8IX21

User Input

>input (1173 residues)
MTRRCMPARPGFPSSPAPGSSPPRCHLRPGSTAHAAAGKRTESPGDRKQSIIDFFKPASK
QDRHMLDSPQKSNIKYGGSRLSITGTEQFERKLSSPKESKPKRVPPEKSPIIEAFMKGVK
EHHEDHGIHESRRPCLSLASKYLAKGTNIYVPSSYHLPKEMKSLKKKHRSPERRKSLFIH
ENNEKNDRDRGKTNADSKKQTTVAEADIFNNSSRSLSSRSSLSRHHPEESPLGAKFQLSL
ASYCRERELKRLRKEQMEQRINSENSFSEASSLSLKSSIERKYKPRQEQRKQNDIIPGKN
NLSNVENGHLSRKRSSSDSWEPTSAGSKQNKFPEKRKRNSVDSDLKSTRESMIPKARESF
LEKRPDGPHQKEKFIKHIALKTPGDVLRLEDISKEPSDETDGSSAGLAPSNSGNSGHHST
RNSDQIQVAGTKETKMQKPHLPLSQEKSAIKKASNLQKNKTASSTTKEKETKLPLLSRVP
SAGSSLVPLNAKNCALPVSKKDKERSSSKECSGHSTESTKHKEHKAKTNKADSNVSSGKI
SGGPLRSEYGTPTKSPPAALEVVPCIPSPAAPSDKAPSEGESSGNSNAGSSALKRKLRGD
FDSDEESLGYNLDSDEEEETLKSLEEIMALNFNQTPAATGKPPALSKGLRSQSSDYTGHV
HPGTYTNTLERLVKEMEDTQRLDELQKQLQEDIRQGRGIKSPIRIGEEDSTDDEDGLLEE
HKEFLKKFSVTIDAIPDHHPGEEIFNFLNSGKIFNQYTLDLRDSGFIGQSAVEKLILKSG
KTDQIFLTTQGFLTSAYHYVQCPVPVLKWLFRMMSVHTDCIVSVQILSTLMEITIRNDTF
SDSPVWPWIPSLSDVAAVFFNMGIDFRSLFPLENLQPDFNEDYLVSETQTTSRGKESEDS
SYKPIFSTLPETNILNVVKFLGLCTSIHPEGYQDREIMLLILMLFKMSLEKQLKQIPLVD
FQSLLINLMKNIRDWNTKVPELCLGINELSSHPHNLLWLVQLVPNWTSRGRQLRQCLSLV
IISKLLDEKHEDVPNASNLQVSVLHRYLVQMKPSDLLKKMVLKKKAEQPDGIIDDSLHLE
LEKQAYYLTYILLHLVGEVSCSHSFSSGQRKHFVLLCGALEKHVKCDIREDARLFYRTKV
KDLVARIHGKWQEIIQNCRPTQGQLHDFWVPDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IX21	1.000	1.000	0.000	1173	1.000	1.000	Q8IX21.pdb.gz	SLF2_HUMAN SMC5-SMC6 complex localization factor protein 2 OS=Homo sapiens OX=9606 GN=SLF2 PE=1 SV=2
2	AFDB:F4K0Y5	0.060	0.061	1.398E-4	1165	0.123	0.124	F4K0Y5.pdb.gz	F4K0Y5_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR16 PE=1 SV=1
3	AFDB:Q57WC1	0.080	0.072	2.136E-4	1387	0.147	0.124	Q57WC1.pdb.gz	Q57WC1_TRYB2 Ancestral coatomer element 1 Sec16/Sec31 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.610 PE=3 SV=1
4	AFDB:P25339	0.098	0.112	2.530E-4	888	0.122	0.161	P25339.pdb.gz	PUF4_YEAST Pumilio homology domain family member 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUF4 PE=1 SV=2
5	AFDB:Q7Z5K2	0.111	0.110	2.754E-4	1190	0.135	0.133	Q7Z5K2.pdb.gz	WAPL_HUMAN Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1
6	AFDB:F4IKX0	0.081	0.085	2.998E-4	1108	0.131	0.139	F4IKX0.pdb.gz	F4IKX0_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR15 PE=1 SV=1
7	AFDB:A0A0R4IZ84	0.110	0.090	6.428E-4	1544	0.147	0.111	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
8	AFDB:E5FYH1	0.084	0.065	8.649E-4	1653	0.135	0.096	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
9	AFDB:Q9SE97	0.049	0.054	8.649E-4	1051	0.131	0.147	Q9SE97.pdb.gz	FH1_ARATH Formin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FH1 PE=1 SV=1
10	AFDB:Q80XI3	0.058	0.052	1.855E-3	1579	0.132	0.098	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
11	PDB:7p3xA	0.064	0.102	2.255E-2	576	0.052	0.106	7p3xA.pdb.gz
12	PDB:5a9qA	0.074	0.077	2.560E-2	1097	0.049	0.053	5a9qA.pdb.gz
13	PDB:6ttuC	0.073	0.101	1.082E-1	701	0.043	0.071	6ttuC.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
14	PDB:7qfwA	0.102	0.131	1.128E-1	823	0.050	0.072	7qfwA.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
15	PDB:7bfpC	0.108	0.284	1.228E-1	298	0.036	0.141	7bfpC.pdb.gz
16	PDB:2xwuB	0.126	0.152	1.337E-1	910	0.053	0.068	2xwuB.pdb.gz
17	PDB:3w3uA	0.085	0.090	1.337E-1	1030	0.036	0.041	3w3uA.pdb.gz
18	PDB:2z6gA	0.120	0.207	1.455E-1	550	0.037	0.078	2z6gA.pdb.gz
19	PDB:3msvA	0.099	0.208	1.455E-1	352	0.041	0.136	3msvA.pdb.gz
20	PDB:7zf1B	0.089	0.089	1.724E-1	1179	0.052	0.052	7zf1B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AL16	0.0	1372	758	0.581	0.900	B1AL16_HUMAN SMC5-SMC6 complex localization factor 2 OS=Homo sapiens OX=9606 GN=SLF2 PE=1 SV=1
2	Q8IX21	0.0	2414	1173	1.000	1.000	SLF2_HUMAN SMC5-SMC6 complex localization factor protein 2 OS=Homo sapiens OX=9606 GN=SLF2 PE=1 SV=2
3	P54256	4.4	33.9	629	0.021	0.040	HAP1_RAT Huntingtin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Hap1 PE=1 SV=1
4	P0A8G3	6.0	33.1	470	0.021	0.053	UXAC_ECOLI Uronate isomerase OS=Escherichia coli (strain K12) OX=83333 GN=uxaC PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14816 CANIN	3e-152	518.5	Coiled-coil and Nse Interacting (CANIN) domain
2	PF17674 HHH_9	3.2e+02	13.7	HHH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359292

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265140	0.964	SMC5-SMC6 complex localization factor protein 1
2	9606.ENSP00000264926	0.930	E3 ubiquitin-protein ligase RAD18
3	9606.ENSP00000355077	0.780	Non-structural maintenance of chromosomes element 1 homolog
4	9606.ENSP00000330694	0.769	Non-structural maintenance of chromosomes element 3 homolog
5	9606.ENSP00000309595	0.764	Twinkle protein, mitochondrial
6	9606.ENSP00000404092	0.685	Structural maintenance of chromosomes protein 6
7	9606.ENSP00000354957	0.651	Structural maintenance of chromosomes protein 5
8	9606.ENSP00000385545	0.623	Kinesin-like protein KIF26B
9	9606.ENSP00000358903	0.602	Steroid 17-alpha-hydroxylase/17,20 lyase
10	9606.ENSP00000363891	0.599	Putative sodium-coupled neutral amino acid transporter 10
11	9606.ENSP00000287437	0.555	E3 SUMO-protein ligase NSE2
12	9606.ENSP00000337804	0.546	Sperm-associated antigen 17
13	9606.ENSP00000376135	0.540	Zinc finger protein 605
14	9606.ENSP00000359319	0.537	Paired box protein Pax-2
15	9606.ENSP00000362702	0.533	Serine/threonine-protein kinase Nek6
16	9606.ENSP00000380174	0.533	Zinc finger and SCAN domain-containing protein 29
17	9606.ENSP00000254037	0.509	Zinc finger CCHC domain-containing protein 9
18	9606.ENSP00000404304	0.504	Armadillo repeat containing, X-linked 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0031625	1.000	ubiquitin protein ligase binding
GO:1901363	0.335	heterocyclic compound binding
GO:0097159	0.335	organic cyclic compound binding
GO:0003824	0.314	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050789	0.984	regulation of biological process
GO:0051726	0.972	regulation of cell cycle
GO:0006974	0.926	cellular response to DNA damage stimulus
GO:0048518	0.919	positive regulation of biological process
GO:0010564	0.910	regulation of cell cycle process
GO:0048522	0.902	positive regulation of cellular process
GO:0006282	0.889	regulation of DNA repair
GO:0034502	0.874	protein localization to chromosome
GO:2001022	0.870	positive regulation of response to DNA damage stimulus
GO:0033044	0.832	regulation of chromosome organization
GO:0045787	0.823	positive regulation of cell cycle
GO:0051130	0.816	positive regulation of cellular component organization
GO:0090068	0.811	positive regulation of cell cycle process
GO:0051173	0.805	positive regulation of nitrogen compound metabolic process
GO:2001252	0.802	positive regulation of chromosome organization
GO:0010604	0.801	positive regulation of macromolecule metabolic process
GO:0051054	0.790	positive regulation of DNA metabolic process
GO:0045739	0.717	positive regulation of DNA repair
GO:0044087	0.655	regulation of cellular component biogenesis
GO:2000779	0.641	regulation of double-strand break repair
GO:0044089	0.558	positive regulation of cellular component biogenesis
GO:0071704	0.506	organic substance metabolic process
GO:0043254	0.484	regulation of protein-containing complex assembly
GO:0044238	0.468	primary metabolic process
GO:0044237	0.465	cellular metabolic process
GO:0006807	0.445	nitrogen compound metabolic process
GO:0043170	0.366	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005694	0.998	chromosome
GO:0090734	0.973	site of DNA damage
GO:0000785	0.927	chromatin
GO:0035861	0.893	site of double-strand break
GO:0005737	0.740	cytoplasm
GO:0005829	0.305	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]