StarFunc result for job id Q8IX30

User Input

>input (993 residues)
MGSGRVPGLCLLVLLVHARAAQYSKAAQDVDECVEGTDNCHIDAICQNTPRSYKCICKSG
YTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGN
GGCQQSCVNMMGSYECHCREGFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKGGI
ACECRPGFELTKNQRDCKLTCNYGNGGCQHTCDDTEQGPRCGCHIKFVLHTDGKTCIETC
AVNNGGCDSKCHDAATGVHCTCPVGFMLQPDRKTCKDIDECRLNNGGCDHICRNTVGSFE
CSCKKGYKLLINERNCQDIDECSFDRTCDHICVNTPGSFQCLCHRGYLLYGITHCGDVDE
CSINRGGCRFGCINTPGSYQCTCPAGQGRLHWNGKDCTEPLKCQGSPGASKAMLSCNRSG
KKDTCALTCPSRARFLPESENGFTVSCGTPSPRAAPARAGHNGNSTNSNHCHEAAVLSIK
QRASFKIKDAKCRLHLRNKGKTEEAGRITGPGGAPCSECQVTFIHLKCDSSRKGKGRRAR
TPPGKEVTRLTLELEAEVRAEETTASCGLPCLRQRMERRLKGSLKMLRKSINQDRFLLRL
AGLDYELAHKPGLVAGERAEPMESCRPGQHRAGTKCVSCPQGTYYHGQTEQCVPCPAGTF
QEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCPPGQHSVDGFKPCQPCPRGTYQPEAGR
TLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNTSIHRCIRCAMGSYQPDFRQNFCS
RCPGNTSTDFDGSTSVAQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKR
KILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKT
SEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAHPQ
NYFKYTEKHKEMLPKSFIKLLRSKVSSFLRPYK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IBT9	0.886	0.885	0.000	994	0.662	0.661	A0A0R4IBT9.pdb.gz	A0A0R4IBT9_DANRE Signal peptide, CUB and EGF-like domain-containing protein 1 isoform 2 precursor OS=Danio rerio OX=7955 GN=im:7427863 PE=4 SV=1
2	AFDB:A0A2R8Q191	0.712	0.706	0.000	1002	0.705	0.699	A0A2R8Q191.pdb.gz
3	AFDB:M1FTT7	0.726	0.704	0.000	1024	0.658	0.638	M1FTT7.pdb.gz
4	AFDB:Q5G872	0.626	0.617	0.000	1010	0.616	0.606	Q5G872.pdb.gz	SCUB2_DANRE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Danio rerio OX=7955 GN=scube2 PE=2 SV=1
5	AFDB:Q66PY1	0.852	0.852	0.000	993	0.958	0.958	Q66PY1.pdb.gz	SCUB3_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Mus musculus OX=10090 GN=Scube3 PE=1 SV=1
6	AFDB:Q6NZL8	0.711	0.694	0.000	1018	0.648	0.632	Q6NZL8.pdb.gz	SCUB1_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Scube1 PE=2 SV=2
7	AFDB:Q8IWY4	0.833	0.837	0.000	988	0.658	0.661	Q8IWY4.pdb.gz	SCUB1_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCUBE1 PE=1 SV=3
8	AFDB:Q9JJS0	0.566	0.564	0.000	997	0.584	0.582	Q9JJS0.pdb.gz	SCUB2_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Mus musculus OX=10090 GN=Scube2 PE=1 SV=1
9	AFDB:Q9NQ36	0.539	0.536	0.000	999	0.598	0.595	Q9NQ36.pdb.gz	SCUB2_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SCUBE2 PE=1 SV=3
10	AFDB:Q86TI6	0.146	0.387	2.380E-40	347	0.211	0.605	Q86TI6.pdb.gz	Q86TI6_HUMAN SCUBE1 protein OS=Homo sapiens OX=9606 GN=SCUBE1 PE=2 SV=1
11	PDB:7q3nU	0.081	0.205	2.225E-6	292	0.052	0.178	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:7b01A	0.089	0.145	3.107E-3	588	0.022	0.037	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
13	PDB:3am2A	0.083	0.240	4.819E-3	286	0.008	0.028	3am2A.pdb.gz
14	PDB:4dxzA	0.076	0.459	7.075E-3	111	0.009	0.081	4dxzA.pdb.gz
15	PDB:4bu2A	0.056	0.128	2.946E-2	379	0.020	0.053	4bu2A.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
16	PDB:1olmE	0.068	0.140	4.094E-2	397	0.012	0.030	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
17	PDB:7ff0A	0.066	0.201	5.098E-2	206	0.013	0.063	7ff0A.pdb.gz	Inhibitory mechanism of gold analogues against Pseudomonas global virulence factor regulator Vfr
18	PDB:1ft9A	0.063	0.217	6.349E-2	210	0.012	0.057	1ft9A.pdb.gz	Structure of the CO sensing transcription activator CooA.
19	PDB:6xwuA	0.060	0.304	6.349E-2	138	0.005	0.036	6xwuA.pdb.gz
20	PDB:3ojiB	0.070	0.239	7.907E-2	185	0.015	0.081	3ojiB.pdb.gz	Complex Structures of the Abscisic Acid Receptor PYL3/RCAR13 Reveal a Unique Regulatory Mechanism

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IBT9	0.0	1347	994	0.660	0.659	A0A0R4IBT9_DANRE Signal peptide, CUB and EGF-like domain-containing protein 1 isoform 2 precursor OS=Danio rerio OX=7955 GN=im:7427863 PE=4 SV=1
2	F1R0I7	0.0	1461	995	0.708	0.707	F1R0I7_DANRE Scube3 OS=Danio rerio OX=7955 GN=scube3 PE=2 SV=3
3	Q5G872	0.0	1235	1010	0.609	0.599	SCUB2_DANRE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Danio rerio OX=7955 GN=scube2 PE=2 SV=1
4	Q66PY1	0.0	1956	993	0.959	0.959	SCUB3_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Mus musculus OX=10090 GN=Scube3 PE=1 SV=1
5	Q6NZL8	0.0	1321	1018	0.649	0.633	SCUB1_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Scube1 PE=2 SV=2
6	Q8IWY4	0.0	1352	988	0.661	0.664	SCUB1_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCUBE1 PE=1 SV=3
7	Q8IX30	0.0	2045	993	1.000	1.000	SCUB3_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SCUBE3 PE=1 SV=1
8	Q9JJS0	0.0	1172	997	0.579	0.577	SCUB2_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Mus musculus OX=10090 GN=Scube2 PE=1 SV=1
9	Q9NQ36	0.0	1204	999	0.595	0.592	SCUB2_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SCUBE2 PE=1 SV=3
10	Q86TI6	3.68e-131	401	347	0.200	0.573	Q86TI6_HUMAN SCUBE1 protein OS=Homo sapiens OX=9606 GN=SCUBE1 PE=2 SV=1
11	O00339	1.82e-61	229	956	0.142	0.147	MATN2_HUMAN Matrilin-2 OS=Homo sapiens OX=9606 GN=MATN2 PE=1 SV=4
12	O08746	3.45e-61	228	956	0.145	0.151	MATN2_MOUSE Matrilin-2 OS=Mus musculus OX=10090 GN=Matn2 PE=2 SV=2
13	Q80V70	3.45e-59	224	1572	0.139	0.088	MEGF6_MOUSE Multiple epidermal growth factor-like domains protein 6 OS=Mus musculus OX=10090 GN=Megf6 PE=2 SV=3
14	F1S0M0	8.10e-58	217	879	0.136	0.154	F1S0M0_PIG Matrilin 2 OS=Sus scrofa OX=9823 GN=MATN2 PE=1 SV=4
15	M9PHP7	8.02e-56	213	1427	0.156	0.109	M9PHP7_DROME Faulty attraction, isoform F OS=Drosophila melanogaster OX=7227 GN=frac PE=4 SV=1
16	Q9VS89	9.75e-54	207	1618	0.141	0.087	Q9VS89_DROME FI18763p1 OS=Drosophila melanogaster OX=7227 GN=frac PE=2 SV=4
17	O75095	1.90e-47	187	1541	0.129	0.083	MEGF6_HUMAN Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens OX=9606 GN=MEGF6 PE=1 SV=4
18	P35556	1.06e-44	179	2912	0.135	0.046	FBN2_HUMAN Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3
19	Q61555	7.17e-44	176	2907	0.133	0.045	FBN2_MOUSE Fibrillin-2 OS=Mus musculus OX=10090 GN=Fbn2 PE=1 SV=2
20	P98133	1.63e-41	169	2871	0.139	0.048	FBN1_BOVIN Fibrillin-1 OS=Bos taurus OX=9913 GN=FBN1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	1.3e-34	129.1	Complement Clr-like EGF-like
2	PF00431 CUB	7.5e-14	63.4	CUB domain
3	PF00008 EGF	9e-10	50.0	EGF-like domain
4	PF12947 EGF_3	1.2e-18	78.3	EGF domain
5	PF07645 EGF_CA	7.6e-27	104.6	Calcium-binding EGF domain
6	PF07699 Ephrin_rec_like	7.1e-33	123.5	Tyrosine-protein kinase ephrin type A/B receptor-like
7	PF14670 FXa_inhibition	2.2e-49	176.7	Coagulation Factor Xa inhibitory site
8	PF12661 hEGF	4.7	19.2	Human growth factor-like EGF
9	PF06247 Plasmod_Pvs28	48	15.7	Pvs28 EGF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274938

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361405	0.932	Matrix metalloproteinase-9
2	9606.ENSP00000219070	0.929	72 kDa type IV collagenase
3	9606.ENSP00000354080	0.919	Signal peptide, CUB and EGF-like domain-containing protein 1
4	9606.ENSP00000351905	0.867	TGF-beta receptor type-2
5	9606.ENSP00000308708	0.811	T-complex protein 11 homolog
6	9606.ENSP00000353518	0.744	Ankyrin repeat and SAM domain-containing protein 1A
7	9606.ENSP00000354633	0.694	Transcription initiation factor TFIID subunit 11
8	9606.ENSP00000307939	0.680	GRIP and coiled-coil domain-containing protein 2
9	9606.ENSP00000229769	0.666	Fanconi anemia group E protein
10	9606.ENSP00000449629	0.637	Ankyrin repeat and sterile alpha motif domain-containing protein 1B
11	9606.ENSP00000342336	0.597	Protein FAM180A
12	9606.ENSP00000389252	0.572	Nephronectin
13	9606.ENSP00000438526	0.553	Kelch-like protein 35
14	9606.ENSP00000260113	0.543	Peptidase inhibitor 15
15	9606.ENSP00000392879	0.537	T-complex 11 family, X-linked 2
16	9606.ENSP00000254898	0.530	Matrilin-2
17	9606.ENSP00000352167	0.511	Mitochondrial basic amino acids transporter

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.883	identical protein binding
GO:0043167	0.844	ion binding
GO:0046872	0.374	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048522	0.968	positive regulation of cellular process
GO:0048583	0.962	regulation of response to stimulus
GO:0009966	0.954	regulation of signal transduction
GO:0009987	0.943	cellular process
GO:0010647	0.900	positive regulation of cell communication
GO:0023056	0.899	positive regulation of signaling
GO:0045667	0.896	regulation of osteoblast differentiation
GO:0009967	0.887	positive regulation of signal transduction
GO:0045597	0.838	positive regulation of cell differentiation
GO:0045669	0.700	positive regulation of osteoblast differentiation
GO:0048856	0.682	anatomical structure development
GO:0045880	0.610	positive regulation of smoothened signaling pathway
GO:0032501	0.486	multicellular organismal process
GO:0050896	0.412	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.995	plasma membrane
GO:0005576	0.961	extracellular region
GO:0009986	0.937	cell surface
GO:0005622	0.820	intracellular anatomical structure
GO:0043226	0.817	organelle
GO:0043231	0.764	intracellular membrane-bounded organelle
GO:0005737	0.733	cytoplasm
GO:0005615	0.501	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]