StarFunc result for job id Q8IXF0

User Input

>input (933 residues)
MAPTKPSFQQDPSRRERITAQHPLPNQSECRKIYRYDGIYCESTYQNLQALRKEKSRDAA
RSRRGKENFEFYELAKLLPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPPWNLRMEG
PPPNTSVKVIGAQRRRSPSALAIEVFEAHLGSHILQSLDGFVFALNQEGKFLYISETVSI
YLGLSQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQSE
TPEPVESTSPSLLTTDNTLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSH
GRTVPSQIMGLVVVAHALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVD
IVGKRCYHFIHAEDVEGIRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKN
ANEKNIIWVNYLLSNPEYKDTPMDIAQLPHLPEKTSESSETSDSESDSKDTSGITEDNEN
SKSDEKGNQSENSEDPEPDRKKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFENP
KAGEDGFGALGAMQIKVERYVESESDLRLQNCESLTSDSAKDSDSAGEAGAQASSKHQKR
KKRRKRQKGGSASRRRLSSASSPGGLDAGLVEPPRLLSSPNSASVLKIKTEISEPINFDN
DSSIWNYPPNREISRNESPYSMTKPPSSEHFPSPQGGGGGGGGGGGLHVAIPDSVLTPPG
ADGAAARKTQFGASATAALAPVASDPLSPPLSASPRDKHPGNGGGGGGGGGGAGGGGPSA
SNSLLYTGDLEALQRLQAGNVVLPLVHRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAM
QSNLLPNAHAVNFVDVNSPGFGLDPKTPMEMLYHHVHRLNMSGPFGGAVSAASLTQMPAG
NVFTTAEGLFSTLPFPVYSNGIHAAQTLERKED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F8VR32	0.432	0.430	0.000	938	0.984	0.979	F8VR32.pdb.gz	F8VR32_HUMAN Neuronal PAS domain protein 3 OS=Homo sapiens OX=9606 GN=NPAS3 PE=1 SV=1
2	AFDB:Q24167	0.337	0.213	5.972E-32	1507	0.209	0.129	Q24167.pdb.gz	SIMA_DROME Protein similar OS=Drosophila melanogaster OX=7227 GN=sima PE=1 SV=2
3	AFDB:E1C4K6	0.179	0.188	4.262E-26	882	0.171	0.181	E1C4K6.pdb.gz	E1C4K6_CHICK Aryl hydrocarbon receptor 2 OS=Gallus gallus OX=9031 PE=2 SV=3
4	AFDB:E1JIM6	0.182	0.169	3.198E-24	1015	0.179	0.165	E1JIM6.pdb.gz	E1JIM6_DROME Spineless, isoform C OS=Drosophila melanogaster OX=7227 GN=ss PE=1 SV=2
5	AFDB:Q1ECW2	0.234	0.234	3.609E-22	933	0.162	0.162	Q1ECW2.pdb.gz	NPS4A_DANRE Neuronal PAS domain-containing protein 4A OS=Danio rerio OX=7955 GN=npas4a PE=2 SV=1
6	AFDB:O09000	0.124	0.091	4.475E-17	1398	0.160	0.107	O09000.pdb.gz	NCOA3_MOUSE Nuclear receptor coactivator 3 OS=Mus musculus OX=10090 GN=Ncoa3 PE=1 SV=2
7	AFDB:O15055	0.129	0.102	2.302E-14	1255	0.182	0.135	O15055.pdb.gz	PER2_HUMAN Period circadian protein homolog 2 OS=Homo sapiens OX=9606 GN=PER2 PE=1 SV=2
8	AFDB:Q8CEE6	0.150	0.108	3.415E-7	1383	0.117	0.079	Q8CEE6.pdb.gz	PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Pask PE=1 SV=3
9	AFDB:Q96RG2	0.139	0.105	3.415E-7	1323	0.115	0.081	Q96RG2.pdb.gz	PASK_HUMAN PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=PASK PE=1 SV=3
10	PDB:6umzA	0.089	0.552	8.301E-4	127	0.010	0.071	6umzA.pdb.gz	Structural and spectroscopic characterization of photoactive yellow protein and photoswitchable fluorescent protein constructs containing heavy atoms.
11	PDB:6jt0A	0.096	0.150	9.888E-4	542	0.019	0.033	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
12	PDB:2wkpA	0.099	0.261	1.772E-3	320	0.023	0.066	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
13	PDB:7d9tA	0.081	0.133	4.508E-3	512	0.024	0.043	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
14	PDB:7rzwB	0.102	0.110	1.448E-2	864	0.012	0.013	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
15	AFDB:Q8JG61	0.043	0.028	2.362E-2	1534	0.093	0.057	Q8JG61.pdb.gz	Q8JG61_DANRE Erythrocyte membrane protein band 4.1 (Elliptocytosis 1, RH-linked) OS=Danio rerio OX=7955 GN=epb41 PE=2 SV=1
16	PDB:7cpxA	0.064	0.038	4.388E-2	2262	0.027	0.011	7cpxA.pdb.gz	Structural basis for the biosynthesis of lovastatin.
17	PDB:6jt0B	0.101	0.153	4.931E-2	576	0.023	0.036	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
18	PDB:2bi0A	0.052	0.102	5.874E-2	330	0.021	0.061	2bi0A.pdb.gz
19	PDB:5a1uE	0.061	0.068	6.227E-2	824	0.019	0.022	5a1uE.pdb.gz
20	PDB:4qdfB	0.050	0.097	1.409E-1	357	0.023	0.059	4qdfB.pdb.gz	Substrate specificities and conformational flexibility of 3-ketosteroid 9 alpha-hydroxylases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8VR32	0.0	1889	938	0.982	0.977	F8VR32_HUMAN Neuronal PAS domain protein 3 OS=Homo sapiens OX=9606 GN=NPAS3 PE=1 SV=1
2	F8VS42	0.0	1816	935	0.947	0.945	F8VS42_HUMAN Neuronal PAS domain protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=NPAS3 PE=1 SV=2
3	Q8IXF0	0.0	1929	933	1.000	1.000	NPAS3_HUMAN Neuronal PAS domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NPAS3 PE=2 SV=1
4	Q9QZQ0	0.0	1633	925	0.932	0.941	NPAS3_MOUSE Neuronal PAS domain-containing protein 3 OS=Mus musculus OX=10090 GN=Npas3 PE=1 SV=1
5	X5D2Q4	0.0	1929	933	1.000	1.000	X5D2Q4_HUMAN Neuronal PAS domain protein 3 isoform A (Fragment) OS=Homo sapiens OX=9606 GN=NPAS3 PE=2 SV=1
6	X5D988	0.0	1844	903	0.968	1.000	X5D988_HUMAN Neuronal PAS domain protein 3 isoform D (Fragment) OS=Homo sapiens OX=9606 GN=NPAS3 PE=2 SV=1
7	Q99742	6.26e-154	468	590	0.257	0.407	NPAS1_HUMAN Neuronal PAS domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NPAS1 PE=2 SV=2
8	P97459	6.11e-152	463	594	0.262	0.411	NPAS1_MOUSE Neuronal PAS domain-containing protein 1 OS=Mus musculus OX=10090 GN=Npas1 PE=1 SV=1
9	Q24119	6.86e-128	413	1022	0.234	0.213	TRH_DROME Protein trachealess OS=Drosophila melanogaster OX=7227 GN=trh PE=1 SV=4
10	Q61079	6.95e-96	318	657	0.196	0.279	SIM2_MOUSE Single-minded homolog 2 OS=Mus musculus OX=10090 GN=Sim2 PE=1 SV=1
11	Q14190	4.42e-95	316	667	0.192	0.268	SIM2_HUMAN Single-minded homolog 2 OS=Homo sapiens OX=9606 GN=SIM2 PE=1 SV=2
12	E1C5G3	9.51e-91	307	766	0.188	0.228	E1C5G3_CHICK SIM bHLH transcription factor 1 OS=Gallus gallus OX=9031 GN=SIM1 PE=4 SV=1
13	P81133	1.05e-90	306	766	0.182	0.222	SIM1_HUMAN Single-minded homolog 1 OS=Homo sapiens OX=9606 GN=SIM1 PE=1 SV=2
14	Q61045	1.44e-90	306	765	0.183	0.224	SIM1_MOUSE Single-minded homolog 1 OS=Mus musculus OX=10090 GN=Sim1 PE=1 SV=3
15	P05709	8.33e-89	300	697	0.181	0.242	SIM_DROME Protein single-minded OS=Drosophila melanogaster OX=7227 GN=sim PE=1 SV=3
16	Q98SJ5	2.58e-87	297	745	0.171	0.215	SIM1A_DANRE Single-minded homolog 1-A OS=Danio rerio OX=7955 GN=sim1a PE=2 SV=1
17	Q9XTA5	1.86e-74	263	823	0.156	0.177	HIF1A_BOVIN Hypoxia-inducible factor 1-alpha OS=Bos taurus OX=9913 GN=HIF1A PE=2 SV=1
18	A8MYV6	1.25e-73	261	827	0.155	0.175	A8MYV6_HUMAN Hypoxia-inducible factor 1-alpha OS=Homo sapiens OX=9606 GN=HIF1A PE=1 SV=1
19	D0VY79	1.27e-73	261	826	0.155	0.176	D0VY79_HUMAN Hypoxia-inducible factor 1-alpha OS=Homo sapiens OX=9606 GN=HIF1A PE=1 SV=1
20	Q16665	1.27e-73	261	826	0.155	0.176	HIF1A_HUMAN Hypoxia-inducible factor 1-alpha OS=Homo sapiens OX=9606 GN=HIF1A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16905 GPHH	6e+02	11.8	Voltage-dependent L-type calcium channel, IQ-associated
2	PF00010 HLH	5.8	18.3	Helix-loop-helix DNA-binding domain
3	PF00989 PAS	1.9e-09	48.9	PAS fold
4	PF14598 PAS_11	8e-10	50.2	PAS domain
5	PF08447 PAS_3	8e-21	85.5	PAS fold
6	PF08448 PAS_4	1.1	20.9	PAS fold
7	PF13426 PAS_9	0.00092	30.8	PAS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348460

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351407	0.957	Aryl hydrocarbon receptor nuclear translocator
2	9606.ENSP00000307479	0.840	Aryl hydrocarbon receptor nuclear translocator 2
3	9606.ENSP00000440915	0.764	Mitochondrial ribonuclease P catalytic subunit
4	9606.ENSP00000280979	0.715	A-kinase anchor protein 6
5	9606.ENSP00000344087	0.679	Autism susceptibility gene 2 protein
6	9606.ENSP00000385780	0.632	Diacylglycerol kinase beta
7	9606.ENSP00000374507	0.598	Protein Daple
8	9606.ENSP00000328326	0.561	XK-related protein 4
9	9606.ENSP00000331040	0.559	Oligodendrocyte transcription factor 2
10	9606.ENSP00000373347	0.556	SLIT-ROBO Rho GTPase-activating protein 3
11	9606.ENSP00000265022	0.548	Diacylglycerol kinase gamma
12	9606.ENSP00000355593	0.533	Disrupted in schizophrenia 1 protein
13	9606.ENSP00000362103	0.531	POU domain, class 3, transcription factor 1
14	9606.ENSP00000355001	0.528	POU domain, class 3, transcription factor 3
15	9606.ENSP00000350071	0.526	Striatin-3
16	9606.ENSP00000483364	0.524	Tectonic-3
17	9606.ENSP00000329170	0.519	POU domain, class 3, transcription factor 2
18	9606.ENSP00000364150	0.511	Polypeptide N-acetylgalactosaminyltransferase 12
19	9606.ENSP00000447852	0.511	Polypeptide N-acetylgalactosaminyltransferase
20	9606.ENSP00000363826	0.509	Frizzled-8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046982	0.997	protein heterodimerization activity
GO:0003677	0.987	DNA binding
GO:0003700	0.985	DNA-binding transcription factor activity
GO:0000981	0.950	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0043565	0.922	sequence-specific DNA binding
GO:0003690	0.809	double-stranded DNA binding
GO:1990837	0.757	sequence-specific double-stranded DNA binding
GO:0140297	0.542	DNA-binding transcription factor binding
GO:0000976	0.412	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0051173	0.972	positive regulation of nitrogen compound metabolic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0031323	0.969	regulation of cellular metabolic process
GO:0050896	0.965	response to stimulus
GO:0045935	0.963	positive regulation of nucleobase-containing compound metabolic process
GO:0051252	0.952	regulation of RNA metabolic process
GO:0032501	0.909	multicellular organismal process
GO:0009889	0.886	regulation of biosynthetic process
GO:0006355	0.877	regulation of DNA-templated transcription
GO:0009987	0.830	cellular process
GO:0010604	0.821	positive regulation of macromolecule metabolic process
GO:0019098	0.713	reproductive behavior
GO:0051254	0.611	positive regulation of RNA metabolic process
GO:0009605	0.600	response to external stimulus
GO:0050877	0.473	nervous system process
GO:0045893	0.421	positive regulation of DNA-templated transcription
GO:0048856	0.331	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.346	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]