StarFunc result for job id Q8IXH6

User Input

>input (220 residues)
MFQRLSSLFFSTPSPPEDPDCPRAFVSEEDEVDGWLIIDLPDSYAAPPSPGAAPAPAGRP
PPAPSLMDESWFVTPPACFTAEGPGLGPARLQSSPLEDLLIEHPSMSVYVTGSTIVLEPG
SPSPLPDAALPDGDLSEGELTPARREPRAARHAAPLPARAALLEKAGQVRRLQRARQRAE
RHALSAKAVQRQNRARESRPRRSKNQSSFIYQPCQRQFNY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IXH6	1.000	1.000	8.385E-37	220	1.000	1.000	Q8IXH6.pdb.gz	T53I2_HUMAN Tumor protein p53-inducible nuclear protein 2 OS=Homo sapiens OX=9606 GN=TP53INP2 PE=1 SV=2
2	AFDB:Q8CFU8	0.333	0.332	6.949E-29	221	0.859	0.855	Q8CFU8.pdb.gz	T53I2_MOUSE Tumor protein p53-inducible nuclear protein 2 OS=Mus musculus OX=10090 GN=Tp53inp2 PE=2 SV=4
3	AFDB:Q9QXE4	0.132	0.123	9.480E-6	239	0.318	0.293	Q9QXE4.pdb.gz	T53I1_MOUSE Tumor protein p53-inducible nuclear protein 1 OS=Mus musculus OX=10090 GN=Trp53inp1 PE=2 SV=1
4	AFDB:A0A024R9C8	0.144	0.140	3.696E-5	240	0.318	0.292	A0A024R9C8.pdb.gz
5	AFDB:M9NFM7	0.167	0.103	7.895E-4	417	0.305	0.161	M9NFM7.pdb.gz	M9NFM7_DROME Diabetes and obesity regulated, isoform G OS=Drosophila melanogaster OX=7227 GN=TP53INP PE=1 SV=1
6	AFDB:Q9C882	0.163	0.071	6.644E-1	587	0.195	0.073	Q9C882.pdb.gz	GTL1_ARATH Trihelix transcription factor GTL1 OS=Arabidopsis thaliana OX=3702 GN=GTL1 PE=1 SV=2
7	AFDB:Q5VX71	0.095	0.048	1.070	490	0.155	0.069	Q5VX71.pdb.gz	SUSD4_HUMAN Sushi domain-containing protein 4 OS=Homo sapiens OX=9606 GN=SUSD4 PE=1 SV=1
8	AFDB:O76512	0.131	0.037	1.843	1069	0.127	0.026	O76512.pdb.gz	RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans OX=6239 GN=smg-2 PE=1 SV=1
9	AFDB:Q24217	0.152	0.145	1.843	232	0.136	0.129	Q24217.pdb.gz	Q24217_DROME PAR domain protein 1-delta OS=Drosophila melanogaster OX=7227 GN=Pdp1 PE=2 SV=2
10	AFDB:Q93373	0.139	0.047	1.973	773	0.218	0.062	Q93373.pdb.gz	LET4_CAEEL Leucine-rich repeat-containing protein let-4 OS=Caenorhabditis elegans OX=6239 GN=let-4 PE=2 SV=2
11	PDB:5o9zP	0.119	0.281	5.616	91	0.050	0.121	5o9zP.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
12	PDB:6ahd9	0.123	0.158	8.447	165	0.050	0.067	6ahd9.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IXH6	4.04e-157	435	220	1.000	1.000	T53I2_HUMAN Tumor protein p53-inducible nuclear protein 2 OS=Homo sapiens OX=9606 GN=TP53INP2 PE=1 SV=2
2	Q8CFU8	8.75e-115	328	221	0.859	0.855	T53I2_MOUSE Tumor protein p53-inducible nuclear protein 2 OS=Mus musculus OX=10090 GN=Tp53inp2 PE=2 SV=4
3	Q9QXE4	3.26e-28	108	239	0.359	0.331	T53I1_MOUSE Tumor protein p53-inducible nuclear protein 1 OS=Mus musculus OX=10090 GN=Trp53inp1 PE=2 SV=1
4	Q96A56	4.51e-27	105	240	0.350	0.321	T53I1_HUMAN Tumor protein p53-inducible nuclear protein 1 OS=Homo sapiens OX=9606 GN=TP53INP1 PE=1 SV=1
5	M9NFM7	2.20e-16	79.0	417	0.282	0.149	M9NFM7_DROME Diabetes and obesity regulated, isoform G OS=Drosophila melanogaster OX=7227 GN=TP53INP PE=1 SV=1
6	P0A6E6	2.9	30.4	139	0.055	0.086	ATPE_ECOLI ATP synthase epsilon chain OS=Escherichia coli (strain K12) OX=83333 GN=atpC PE=1 SV=2
7	Q96JA4	3.7	31.2	679	0.100	0.032	M4A14_HUMAN Membrane-spanning 4-domains subfamily A member 14 OS=Homo sapiens OX=9606 GN=MS4A14 PE=1 SV=2
8	Q57VV6	4.8	30.8	2127	0.095	0.010	Q57VV6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.29K2.790 PE=4 SV=1
9	Q20010	6.3	30.0	404	0.127	0.069	SAS5_CAEEL Spindle assembly abnormal protein 5 OS=Caenorhabditis elegans OX=6239 GN=sas-5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14839 DOR	1.2e-33	128.5	DOR family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363943

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262291	0.940	Vacuole membrane protein 1
2	9606.ENSP00000037243	0.932	Gamma-aminobutyric acid receptor-associated protein-like 2
3	9606.ENSP00000306866	0.918	Gamma-aminobutyric acid receptor-associated protein
4	9606.ENSP00000266458	0.882	Gamma-aminobutyric acid receptor-associated protein-like 1
5	9606.ENSP00000455442	0.681	Nuclear protein 2
6	9606.ENSP00000433623	0.649	TNF receptor-associated factor 6
7	9606.ENSP00000363970	0.634	Microtubule-associated proteins 1A/1B light chain 3A
8	9606.ENSP00000319914	0.613	Transcriptional and immune response regulator
9	9606.ENSP00000268607	0.539	Microtubule-associated proteins 1A/1B light chain 3B
10	9606.ENSP00000436152	0.538	Tumor protein p53 inducible protein 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0044237	0.986	cellular metabolic process
GO:0016236	0.982	macroautophagy
GO:0031325	0.973	positive regulation of cellular metabolic process
GO:0019219	0.967	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.957	positive regulation of macromolecule metabolic process
GO:0009889	0.933	regulation of biosynthetic process
GO:0051173	0.884	positive regulation of nitrogen compound metabolic process
GO:0071840	0.844	cellular component organization or biogenesis
GO:0031326	0.795	regulation of cellular biosynthetic process
GO:0051252	0.795	regulation of RNA metabolic process
GO:0006355	0.793	regulation of DNA-templated transcription
GO:0016043	0.786	cellular component organization
GO:0006996	0.571	organelle organization
GO:0050896	0.483	response to stimulus
GO:0071704	0.423	organic substance metabolic process
GO:0051716	0.412	cellular response to stimulus
GO:0051179	0.386	localization
GO:0009891	0.366	positive regulation of biosynthetic process
GO:0045935	0.366	positive regulation of nucleobase-containing compound metabolic process
GO:0048519	0.349	negative regulation of biological process
GO:0006807	0.334	nitrogen compound metabolic process
GO:0044238	0.333	primary metabolic process
GO:0048523	0.323	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0005776	0.995	autophagosome
GO:0016020	0.851	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]