StarFunc result for job id Q8IXI2

User Input

>input (618 residues)
MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSE
AEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKS
DLVEYSSMETILPIMNQYTEIETCVECSAKNLKNISELFYYAQKAVLHPTGPLYCPEEKE
MKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNTPLAPQALEDVKNVVRKHISDG
VADSGLTLKGFLFLHTLFIQRGRHETTWTVLRRFGYDDDLDLTPEYLFPLLKIPPDCTTE
LNHHAYLFLQSTFDKHDLDRDCALSPDELKDLFKVFPYIPWGPDVNNTVCTNERGWITYQ
GFLSQWTLTTYLDVQRCLEYLGYLGYSILTEQESQASAVTVTRDKKIDLQKKQTQRNVFR
CNVIGVKNCGKSGVLQALLGRNLMRQKKIREDHKSYYAINTVYVYGQEKYLLLHDISESE
FLTEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSI
SPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYPHVTQADLKSSTFWLRASFGA
TVFAVLGFAMYKALLKQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K777	0.924	0.761	0.000	752	0.972	0.799	A0A0G2K777.pdb.gz	A0A0G2K777_RAT Ras homolog family member T1 OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=1 SV=1
2	AFDB:A0A0R4IGX0	0.941	0.879	0.000	661	0.793	0.741	A0A0R4IGX0.pdb.gz
3	AFDB:Q6NVC5	0.997	0.995	0.000	619	0.861	0.859	Q6NVC5.pdb.gz	MIRO1_DANRE Mitochondrial Rho GTPase 1-A OS=Danio rerio OX=7955 GN=rhot1a PE=2 SV=1
4	AFDB:Q32LU1	0.963	0.965	8.171E-91	617	0.613	0.614	Q32LU1.pdb.gz	MIRO2_DANRE Mitochondrial Rho GTPase 2 OS=Danio rerio OX=7955 GN=rhot2 PE=2 SV=1
5	AFDB:Q8JZN7	0.931	0.928	1.012E-87	620	0.591	0.589	Q8JZN7.pdb.gz	MIRO2_MOUSE Mitochondrial Rho GTPase 2 OS=Mus musculus OX=10090 GN=Rhot2 PE=1 SV=1
6	AFDB:Q8IXI1	0.918	0.918	1.145E-85	618	0.597	0.597	Q8IXI1.pdb.gz	MIRO2_HUMAN Mitochondrial Rho GTPase 2 OS=Homo sapiens OX=9606 GN=RHOT2 PE=1 SV=2
7	AFDB:Q8IMX7	0.938	0.890	2.165E-81	652	0.524	0.497	Q8IMX7.pdb.gz	MIRO_DROME Mitochondrial Rho GTPase OS=Drosophila melanogaster OX=7227 GN=Miro PE=1 SV=1
8	AFDB:Q94263	0.913	0.903	3.507E-75	625	0.437	0.432	Q94263.pdb.gz	MIRO1_CAEEL Mitochondrial Rho GTPase 1 OS=Caenorhabditis elegans OX=6239 GN=miro-1 PE=3 SV=1
9	AFDB:O59781	0.850	0.835	2.872E-58	630	0.332	0.325	O59781.pdb.gz	GEM1_SCHPO Mitochondrial Rho GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gem1 PE=3 SV=1
10	AFDB:Q8RXF8	0.582	0.561	3.712E-57	648	0.364	0.347	Q8RXF8.pdb.gz	MIRO1_ARATH Mitochondrial Rho GTPase 1 OS=Arabidopsis thaliana OX=3702 GN=MIRO1 PE=1 SV=1
11	PDB:5szjA	0.241	0.792	1.592E-10	175	0.063	0.223	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
12	PDB:2j0vB	0.243	0.770	3.668E-10	184	0.065	0.217	2j0vB.pdb.gz	The Crystal Structure of Arabidopsis Thaliana Rac7/Rop9: The First Ras Superfamily Gtpase from the Plant Kingdom.
13	PDB:6ukaA	0.248	0.819	3.878E-10	177	0.068	0.237	6ukaA.pdb.gz	Structure of the DOCK2-ELMO1 complex provides insights into regulation of the auto-inhibited state.
14	PDB:2wkpA	0.234	0.439	1.056E-9	320	0.073	0.141	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
15	PDB:4mitC	0.232	0.742	1.319E-9	181	0.074	0.254	4mitC.pdb.gz	Entamoeba histolytica RacC Selectively Engages p21-Activated Kinase Effectors.
16	PDB:2atxA	0.230	0.722	1.947E-9	186	0.074	0.247	2atxA.pdb.gz	An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
17	PDB:6zizA	0.236	0.804	2.718E-9	170	0.066	0.241	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
18	PDB:6kykC	0.235	0.799	3.395E-9	169	0.061	0.225	6kykC.pdb.gz	Shank3 Binds to and Stabilizes the Active Form of Rap1 and HRas GTPases via Its NTD-ANK Tandem with Distinct Mechanisms.
19	PDB:5sziA	0.232	0.761	3.590E-9	174	0.063	0.224	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
20	PDB:2ntyC	0.224	0.739	4.012E-9	173	0.070	0.249	2ntyC.pdb.gz	Structural Evidence for a Common Intermediate in Small G Protein-GEF Reactions

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K777	0.0	1199	752	0.917	0.754	A0A0G2K777_RAT Ras homolog family member T1 OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=1 SV=1
2	A0A0G2K8T2	0.0	1256	663	0.976	0.910	A0A0G2K8T2_RAT Mitochondrial Rho GTPase OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=1 SV=1
3	A0A8I6AGU0	0.0	1251	672	0.976	0.897	A0A8I6AGU0_RAT Mitochondrial Rho GTPase OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=3 SV=1
4	A0A8I6AMM4	0.0	1246	612	0.955	0.964	A0A8I6AMM4_RAT Mitochondrial Rho GTPase OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=1 SV=1
5	A0A8I6AVD9	0.0	1196	704	0.917	0.805	A0A8I6AVD9_RAT Mitochondrial Rho GTPase OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=1 SV=1
6	A1L1L6	0.0	1272	631	0.976	0.956	A1L1L6_RAT Mitochondrial Rho GTPase OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=2 SV=1
7	B3DI88	0.0	1035	660	0.798	0.747	B3DI88_DANRE Mitochondrial Rho GTPase OS=Danio rerio OX=7955 GN=si:dkeyp-97g3.6 PE=2 SV=1
8	F7EK49	0.0	1235	629	0.953	0.936	F7EK49_RAT Mitochondrial Rho GTPase OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=1 SV=1
9	Q32LU1	0.0	787	617	0.615	0.616	MIRO2_DANRE Mitochondrial Rho GTPase 2 OS=Danio rerio OX=7955 GN=rhot2 PE=2 SV=1
10	Q6NVC5	0.0	1144	619	0.861	0.859	MIRO1_DANRE Mitochondrial Rho GTPase 1-A OS=Danio rerio OX=7955 GN=rhot1a PE=2 SV=1
11	Q8BG51	0.0	1274	631	0.979	0.959	MIRO1_MOUSE Mitochondrial Rho GTPase 1 OS=Mus musculus OX=10090 GN=Rhot1 PE=1 SV=1
12	Q8IMX7	0.0	657	652	0.534	0.506	MIRO_DROME Mitochondrial Rho GTPase OS=Drosophila melanogaster OX=7227 GN=Miro PE=1 SV=1
13	Q8IXI1	0.0	763	618	0.602	0.602	MIRO2_HUMAN Mitochondrial Rho GTPase 2 OS=Homo sapiens OX=9606 GN=RHOT2 PE=1 SV=2
14	Q8IXI2	0.0	1291	618	1.000	1.000	MIRO1_HUMAN Mitochondrial Rho GTPase 1 OS=Homo sapiens OX=9606 GN=RHOT1 PE=1 SV=2
15	Q8JZN7	0.0	743	620	0.592	0.590	MIRO2_MOUSE Mitochondrial Rho GTPase 2 OS=Mus musculus OX=10090 GN=Rhot2 PE=1 SV=1
16	Q94263	0.0	553	625	0.443	0.438	MIRO1_CAEEL Mitochondrial Rho GTPase 1 OS=Caenorhabditis elegans OX=6239 GN=miro-1 PE=3 SV=1
17	F4J0W4	9.25e-127	389	643	0.396	0.381	MIRO2_ARATH Mitochondrial Rho GTPase 2 OS=Arabidopsis thaliana OX=3702 GN=MIRO2 PE=2 SV=1
18	Q8RXF8	1.29e-121	376	648	0.350	0.333	MIRO1_ARATH Mitochondrial Rho GTPase 1 OS=Arabidopsis thaliana OX=3702 GN=MIRO1 PE=1 SV=1
19	O59781	4.95e-111	348	630	0.343	0.337	GEM1_SCHPO Mitochondrial Rho GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gem1 PE=3 SV=1
20	Q55G45	3.53e-103	328	658	0.290	0.272	GEMA_DICDI Probable mitochondrial Rho GTPase gemA OS=Dictyostelium discoideum OX=44689 GN=gemA PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	16	16.9	AAA domain
2	PF13175 AAA_15	88	14.1	AAA ATPase domain
3	PF13191 AAA_16	1.4e+02	14.2	AAA ATPase domain
4	PF13401 AAA_22	64	15.3	AAA domain
5	PF00005 ABC_tran	3.2e+02	13.2	ABC transporter
6	PF00025 Arf	0.001	30.0	ADP-ribosylation factor family
7	PF00350 Dynamin_N	2.5	19.6	Dynamin family
8	PF00036 EF-hand_1	0.012	26.2	EF hand
9	PF13202 EF-hand_5	1.1e+02	13.7	EF hand
10	PF13405 EF-hand_6	0.0089	26.8	EF-hand domain
11	PF13499 EF-hand_7	0.024	26.4	EF-hand domain pair
12	PF13833 EF-hand_8	1.4e+02	13.7	EF-hand domain pair
13	PF08355 EF_assoc_1	3.6e-25	98.6	EF hand associated
14	PF08356 EF_assoc_2	4.5e-32	121.2	EF hand associated
15	PF02421 FeoB_N	5.1	18.1	Ferrous iron transport protein B
16	PF01926 MMR_HSR1	0.0042	28.6	50S ribosome-binding GTPase
17	PF10662 PduV-EutP	3.6	18.8	Ethanolamine utilisation - propanediol utilisation
18	PF03835 Rad4	14	16.8	Rad4 transglutaminase-like domain
19	PF00071 Ras	2.5e-23	93.9	Ras family
20	PF00910 RNA_helicase	5.4	18.8	RNA helicase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9913.ENSBTAP00000035196

Rank	PPI partner	STRING score	Description
1	9913.ENSBTAP00000029455	0.981	Bos taurus PTEN induced putative kinase 1 (PINK1), mRNA
2	9913.ENSBTAP00000019878	0.973	Bos taurus trafficking protein, kinesin binding 2 (TRAK2), mRNA
3	9913.ENSBTAP00000021398	0.957	Trafficking kinesin-binding protein 1
4	9913.ENSBTAP00000054449	0.932	Bos taurus parkinson protein 2, E3 ubiquitin protein ligase (parkin) (PARK2), mRNA
5	9913.ENSBTAP00000043671	0.866	Mitofusin 2
6	9913.ENSBTAP00000013860	0.865	Uncharacterized protein
7	9913.ENSBTAP00000024127	0.841	Kinesin-like protein
8	9913.ENSBTAP00000005979	0.821	Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution (By similarity)
9	9913.ENSBTAP00000005059	0.817	Bos taurus mitochondrial calcium uniporter (MCU), mRNA
10	9913.ENSBTAP00000053353	0.812	Uncharacterized protein
11	9913.ENSBTAP00000009921	0.770	Peroxisomal biogenesis factor 19
12	9913.ENSBTAP00000028441	0.746	Uncharacterized protein
13	9913.ENSBTAP00000041815	0.737	Syntaphilin
14	9913.ENSBTAP00000055097	0.719	Myosin XIX
15	9913.ENSBTAP00000051767	0.712	Bos taurus armadillo repeat containing, X-linked 1 (ARMCX1), mRNA
16	9913.ENSBTAP00000033805	0.706	Kinesin-like protein
17	9913.ENSBTAP00000010389	0.703	Mitochondrial fission 1 protein
18	9913.ENSBTAP00000056410	0.693	Uncharacterized protein
19	9913.ENSBTAP00000018822	0.650	Armadillo repeat containing 10
20	9913.ENSBTAP00000032241	0.633	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016787	0.519	hydrolase activity
GO:0097159	0.430	organic cyclic compound binding
GO:0043167	0.413	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0051234	0.989	establishment of localization
GO:0007018	0.988	microtubule-based movement
GO:0051656	0.950	establishment of organelle localization
GO:0034643	0.938	establishment of mitochondrion localization, microtubule-mediated
GO:1903530	0.923	regulation of secretion by cell
GO:0023051	0.742	regulation of signaling
GO:0010646	0.731	regulation of cell communication
GO:0065008	0.721	regulation of biological quality
GO:0032386	0.710	regulation of intracellular transport
GO:0046928	0.695	regulation of neurotransmitter secretion
GO:0060632	0.653	regulation of microtubule-based movement
GO:0050896	0.394	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0016020	0.758	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.519	Hydrolases.

[back to server]