StarFunc result for job id Q8IXJ6

User Input

>input (389 residues)
MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLD
ELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFE
ISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQ
EDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLP
ARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMI
MGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGV
PNPSTSASPKKSPPPAKDEARTTEREKPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IXJ6	1.000	1.000	6.390E-78	389	1.000	1.000	Q8IXJ6.pdb.gz	SIR2_HUMAN NAD-dependent protein deacetylase sirtuin-2 OS=Homo sapiens OX=9606 GN=SIRT2 PE=1 SV=2
2	AFDB:Q8VDQ8	0.827	0.827	1.118E-71	389	0.877	0.877	Q8VDQ8.pdb.gz	SIR2_MOUSE NAD-dependent protein deacetylase sirtuin-2 OS=Mus musculus OX=10090 GN=Sirt2 PE=1 SV=2
3	AFDB:Q7ZVK3	0.779	0.799	6.479E-56	379	0.609	0.625	Q7ZVK3.pdb.gz	SIR2_DANRE NAD-dependent protein deacetylase sirtuin-2 OS=Danio rerio OX=7955 GN=sirt2 PE=1 SV=1
4	PDB:5fyqA	0.705	0.966	1.028E-50	282	0.722	0.996	5fyqA.pdb.gz	Insights Into Lysine-Deacetylation of Natively Folded Substrate Proteins by Sirtuins.
5	AFDB:Q9I7I7	0.747	0.817	3.265E-46	355	0.445	0.487	Q9I7I7.pdb.gz	SIRT2_DROME NAD-dependent protein deacetylase Sirt2 OS=Drosophila melanogaster OX=7227 GN=Sirt2 PE=3 SV=1
6	AFDB:Q54QE6	0.702	0.535	2.049E-42	512	0.432	0.328	Q54QE6.pdb.gz	SIR2A_DICDI NAD-dependent deacetylase sir2A OS=Dictyostelium discoideum OX=44689 GN=sir2A PE=2 SV=1
7	AFDB:Q9NTG7	0.682	0.666	1.082E-36	399	0.404	0.393	Q9NTG7.pdb.gz	SIR3_HUMAN NAD-dependent protein deacetylase sirtuin-3, mitochondrial OS=Homo sapiens OX=9606 GN=SIRT3 PE=1 SV=2
8	AFDB:Q8R104	0.685	0.795	1.375E-36	334	0.388	0.452	Q8R104.pdb.gz	SIR3_MOUSE NAD-dependent protein deacetylase sirtuin-3 OS=Mus musculus OX=10090 GN=Sirt3 PE=1 SV=2
9	AFDB:Q9USN7	0.670	0.783	3.806E-36	332	0.362	0.425	Q9USN7.pdb.gz	HST2_SCHPO NAD-dependent protein deacetylase hst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hst2 PE=3 SV=1
10	AFDB:Q57V41	0.695	0.768	2.936E-33	351	0.303	0.336	Q57V41.pdb.gz	SIR2_TRYB2 NAD-dependent protein deacetylase SIR2rp1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=SIR2rp1 PE=1 SV=1
11	AFDB:P53686	0.642	0.698	1.581E-30	357	0.324	0.353	P53686.pdb.gz	HST2_YEAST NAD-dependent protein deacetylase HST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HST2 PE=1 SV=1
12	PDB:1q14A	0.573	0.757	1.085E-25	289	0.288	0.388	1q14A.pdb.gz	Structure and autoregulation of the Yeast Hst2 homolog of Sir2
13	PDB:3u31A	0.540	0.775	2.984E-18	263	0.170	0.251	3u31A.pdb.gz	Plasmodium falciparum Sir2A Preferentially Hydrolyzes Medium and Long Chain Fatty Acyl Lysine
14	PDB:7cl1A	0.462	0.596	1.464E-16	296	0.177	0.233	7cl1A.pdb.gz	Reply to: Binding site for MDL-801 on SIRT6.
15	PDB:6fkyB	0.520	0.731	2.461E-13	266	0.162	0.237	6fkyB.pdb.gz	Potent and Selective Inhibitors of Human Sirtuin 5.
16	PDB:4o9uB	0.291	0.260	5.362E-4	440	0.111	0.098	4o9uB.pdb.gz	Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer.
17	PDB:2nshA	0.148	0.272	7.940E-3	163	0.057	0.135	2nshA.pdb.gz	N(5)-CAIR Mutase: Role of a CO(2) Binding Site and Substrate Movement in Catalysis.
18	PDB:3l9wB	0.118	0.124	5.084E-2	357	0.105	0.115	3l9wB.pdb.gz	Mechanism of ligand-gated potassium efflux in bacterial pathogens.
19	PDB:3bg5B	0.130	0.073	5.731E-2	1074	0.103	0.037	3bg5B.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
20	PDB:3zxwA	0.134	0.123	6.084E-2	464	0.090	0.075	3zxwA.pdb.gz	Structure of Ribulose-1,5-Bisphosphate Carboxylase Oxygenase from Thermosynechococcus Elongatus

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5RJQ4	0.0	619	350	0.784	0.871	SIR2_RAT NAD-dependent protein deacetylase sirtuin-2 OS=Rattus norvegicus OX=10116 GN=Sirt2 PE=1 SV=1
2	Q8IXJ6	0.0	802	389	1.000	1.000	SIR2_HUMAN NAD-dependent protein deacetylase sirtuin-2 OS=Homo sapiens OX=9606 GN=SIRT2 PE=1 SV=2
3	Q8VDQ8	0.0	698	389	0.877	0.877	SIR2_MOUSE NAD-dependent protein deacetylase sirtuin-2 OS=Mus musculus OX=10090 GN=Sirt2 PE=1 SV=2
4	E7EWX6	6.01e-177	493	237	0.609	1.000	E7EWX6_HUMAN Sirtuin 2 (Fragment) OS=Homo sapiens OX=9606 GN=SIRT2 PE=1 SV=1
5	Q7ZVK3	1.11e-176	498	379	0.620	0.636	SIR2_DANRE NAD-dependent protein deacetylase sirtuin-2 OS=Danio rerio OX=7955 GN=sirt2 PE=1 SV=1
6	A0A0A0MRF5	5.78e-170	476	234	0.586	0.974	A0A0A0MRF5_HUMAN Sirtuin 2 OS=Homo sapiens OX=9606 GN=SIRT2 PE=1 SV=1
7	Q9I7I7	3.04e-120	354	355	0.452	0.496	SIRT2_DROME NAD-dependent protein deacetylase Sirt2 OS=Drosophila melanogaster OX=7227 GN=Sirt2 PE=3 SV=1
8	Q54QE6	1.07e-105	322	512	0.409	0.311	SIR2A_DICDI NAD-dependent deacetylase sir2A OS=Dictyostelium discoideum OX=44689 GN=sir2A PE=2 SV=1
9	F7EYD5	1.10e-99	301	334	0.375	0.437	F7EYD5_RAT NAD-dependent protein deacetylase OS=Rattus norvegicus OX=10116 GN=Sirt3 PE=1 SV=1
10	C6ZII9	1.14e-99	300	320	0.375	0.456	C6ZII9_RAT NAD-dependent protein deacetylase OS=Rattus norvegicus OX=10116 GN=Sirt3 PE=2 SV=1
11	A0A8I5XWT5	1.20e-99	301	347	0.375	0.421	A0A8I5XWT5_RAT Sirtuin 3 OS=Rattus norvegicus OX=10116 GN=Sirt3 PE=1 SV=1
12	Q9NTG7	4.98e-97	296	399	0.380	0.371	SIR3_HUMAN NAD-dependent protein deacetylase sirtuin-3, mitochondrial OS=Homo sapiens OX=9606 GN=SIRT3 PE=1 SV=2
13	Q8R104	1.91e-96	293	334	0.378	0.440	SIR3_MOUSE NAD-dependent protein deacetylase sirtuin-3 OS=Mus musculus OX=10090 GN=Sirt3 PE=1 SV=2
14	B2RZ31	4.55e-94	284	257	0.357	0.541	B2RZ31_RAT NAD-dependent protein deacetylase OS=Rattus norvegicus OX=10116 GN=Sirt3 PE=2 SV=1
15	Q9USN7	1.74e-89	275	332	0.347	0.407	HST2_SCHPO NAD-dependent protein deacetylase hst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hst2 PE=3 SV=1
16	A0A8I6A7C4	1.41e-82	255	286	0.326	0.444	A0A8I6A7C4_RAT NAD-dependent protein deacetylase OS=Rattus norvegicus OX=10116 GN=Sirt3 PE=1 SV=1
17	P53686	3.49e-71	229	357	0.337	0.367	HST2_YEAST NAD-dependent protein deacetylase HST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HST2 PE=1 SV=1
18	Q54GV7	3.68e-68	226	542	0.321	0.231	SIR2D_DICDI NAD-dependent deacetylase sir2D OS=Dictyostelium discoideum OX=44689 GN=sir2D PE=2 SV=1
19	E7F8W3	2.74e-65	222	710	0.303	0.166	E7F8W3_DANRE NAD-dependent protein deacetylase sirtuin-1 isoform X1 OS=Danio rerio OX=7955 GN=sirt1 PE=1 SV=1
20	Q57V41	5.07e-64	210	351	0.303	0.336	SIR2_TRYB2 NAD-dependent protein deacetylase SIR2rp1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=SIR2rp1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16124 RecQ_Zn_bind	5.9e+02	12.6	RecQ zinc-binding
2	PF02146 SIR2	7.9e-55	197.1	Sir2 family
3	PF14169 YdjO	84	14.3	Cold-inducible protein YdjO

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000249396

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368880	0.996	Forkhead box protein O1
2	9606.ENSP00000334061	0.986	Histone deacetylase 6
3	9606.ENSP00000222553	0.979	Nicotinamide phosphoribosyltransferase
4	9606.ENSP00000283921	0.979	Homeobox protein Hox-A10
5	9606.ENSP00000354916	0.978	Dual specificity protein phosphatase CDC14A
6	9606.ENSP00000337976	0.951	Histone-lysine N-methyltransferase SUV39H1
7	9606.ENSP00000212015	0.946	NAD-dependent protein deacetylase sirtuin-1
8	9606.ENSP00000441434	0.942	Nicotinamide N-methyltransferase
9	9606.ENSP00000230792	0.927	Peroxisomal NADH pyrophosphatase NUDT12
10	9606.ENSP00000264663	0.925	NAD(P) transhydrogenase, mitochondrial
11	9606.ENSP00000326424	0.923	Glutamine-dependent NAD(+) synthetase
12	9606.ENSP00000354532	0.922	Purine nucleoside phosphorylase
13	9606.ENSP00000216274	0.921	Receptor-interacting serine/threonine-protein kinase 3
14	9606.ENSP00000369703	0.910	Tubulin beta-2A chain
15	9606.ENSP00000336799	0.909	Tubulin alpha-1B chain
16	9606.ENSP00000371362	0.909	NAD kinase 2, mitochondrial
17	9606.ENSP00000350686	0.908	Ankyrin repeat and LEM domain-containing protein 2
18	9606.ENSP00000254605	0.906	Ribosomal RNA-processing protein 8
19	9606.ENSP00000396976	0.900	Bromo adjacent homology domain-containing 1 protein
20	9606.ENSP00000263253	0.895	Histone acetyltransferase p300

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0034979	0.998	NAD-dependent protein deacetylase activity
GO:0004407	0.998	histone deacetylase activity
GO:0017136	0.975	NAD-dependent histone deacetylase activity
GO:1901363	0.899	heterocyclic compound binding
GO:0019899	0.899	enzyme binding
GO:0097159	0.870	organic cyclic compound binding
GO:0043167	0.796	ion binding
GO:0016740	0.704	transferase activity
GO:0008134	0.420	transcription factor binding
GO:0003676	0.349	nucleic acid binding
GO:0003950	0.335	NAD+ ADP-ribosyltransferase activity
GO:0051287	0.300	NAD binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044238	0.999	primary metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0019538	0.985	protein metabolic process
GO:0036211	0.976	protein modification process
GO:0048519	0.967	negative regulation of biological process
GO:0098732	0.965	macromolecule deacylation
GO:0006476	0.962	protein deacetylation
GO:0019222	0.959	regulation of metabolic process
GO:0031323	0.925	regulation of cellular metabolic process
GO:0048523	0.893	negative regulation of cellular process
GO:0060255	0.865	regulation of macromolecule metabolic process
GO:0032502	0.856	developmental process
GO:0048518	0.780	positive regulation of biological process
GO:0080090	0.754	regulation of primary metabolic process
GO:0051171	0.754	regulation of nitrogen compound metabolic process
GO:0048522	0.743	positive regulation of cellular process
GO:0009892	0.706	negative regulation of metabolic process
GO:0010468	0.683	regulation of gene expression
GO:0071840	0.658	cellular component organization or biogenesis
GO:0016043	0.651	cellular component organization
GO:0044237	0.650	cellular metabolic process
GO:0031324	0.639	negative regulation of cellular metabolic process
GO:0050896	0.605	response to stimulus
GO:0032501	0.562	multicellular organismal process
GO:0010605	0.561	negative regulation of macromolecule metabolic process
GO:0051716	0.519	cellular response to stimulus
GO:0019219	0.506	regulation of nucleobase-containing compound metabolic process
GO:0051239	0.499	regulation of multicellular organismal process
GO:0009889	0.490	regulation of biosynthetic process
GO:0031326	0.470	regulation of cellular biosynthetic process
GO:0048583	0.462	regulation of response to stimulus
GO:0010556	0.447	regulation of macromolecule biosynthetic process
GO:0051172	0.439	negative regulation of nitrogen compound metabolic process
GO:0006950	0.434	response to stress
GO:0009893	0.427	positive regulation of metabolic process
GO:0048856	0.404	anatomical structure development
GO:0006355	0.366	regulation of DNA-templated transcription
GO:0010604	0.354	positive regulation of macromolecule metabolic process
GO:0051173	0.341	positive regulation of nitrogen compound metabolic process
GO:0031325	0.341	positive regulation of cellular metabolic process
GO:0050793	0.324	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0070013	0.995	intracellular organelle lumen
GO:0031981	0.992	nuclear lumen
GO:0005654	0.969	nucleoplasm
GO:0005829	0.965	cytosol
GO:0016020	0.926	membrane
GO:0071944	0.831	cell periphery
GO:0005886	0.719	plasma membrane
GO:0005730	0.657	nucleolus
GO:0005694	0.404	chromosome
GO:0015630	0.358	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58196	0.998	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	0.998	histone deacetylase.
EC:2.-.-.-	0.704	Transferases.
EC:2.4.2.30	0.335	NAD(+) ADP-ribosyltransferase.

[back to server]