StarFunc result for job id Q8IXJ9

User Input

>input (1541 residues)
MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMRSGTSPLACLNAML
HSNSRGGEGLFYKLPGRISLFTLKKDALQWSRHPATVEGEEPEDTADVESCGSNEASTVS
GENDVSLDETSSNASCSTESQSRPLSNPRDSYRASSQANKQKKKTGVMLPRVVLTPLKVN
GAHVESASGFSGCHADGESGSPSSSSSGSLALGSAAIRGQAEVTQDPAPLLRGFRKPATG
QMKRNRGEEIDFETPGSILVNTNLRALINSRTFHALPSHFQQQLLFLLPEVDRQVGTDGL
LRLSSSALNNEFFTHAAQSWRERLADGEFTHEMQVRIRQEMEKEKKVEQWKEKFFEDYYG
QKLGLTKEESLQQNVGQEEAEIKSGLCVPGESVRIQRGPATRQRDGHFKKRSRPDLRTRA
RRNLYKKQESEQAGVAKDAKSVASDVPLYKDGEAKTDPAGLSSPHLPGTSSAAPDLEGPE
FPVESVASRIQAEPDNLARASASPDRIPSLPQETVDQEPKDQKRKSFEQAASASFPEKKP
RLEDRQSFRNTIESVHTEKPQPTKEEPKVPPIRIQLSRIKPPWVVKGQPTYQICPRIIPT
TESSCRGWTGARTLADIKARALQVRGARGHHCHREAATTAIGGGGGPGGGGGGATDEGGG
RGSSSGDGGEACGHPEPRGGPSTPGKCTSDLQRTQLLPPYPLNGEHTQAGTAMSRARRED
LPSLRKEESCLLQRATVGLTDGLGDASQLPVAPTGDQPCQALPLLSSQTSVAERLVEQPQ
LHPDVRTECESGTTSWESDDEEQGPTVPADNGPIPSLVGDDTLEKGTGQALDSHPTMKDP
VNVTPSSTPESSPTDCLQNRAFDDELGLGGSCPPMRESDTRQENLKTKALVSNSSLHWIP
IPSNDEVVKQPKPESREHIPSVEPQVGEEWEKAAPTPPALPGDLTAEEGLDPLDSLTSLW
TVPSRGGSDSNGSYCQQVDIEKLKINGDSEALSPHGESTDTASDFEGHLTEDSSEADTRE
AAVTKGSSVDKDEKPNWNQSAPLSKVNGDMRLVTRTDGMVAPQSWVSRVCAVRQKIPDSL
LLASTEYQPRAVCLSMPGSSVEATNPLVMQLLQGSLPLEKVLPPAHDDSMSESPQVPLTK
DQSHGSLRMGSLHGLGKNSGMVDGSSPSSLRALKEPLLPDSCETGTGLARIEATQAPGAP
QKNCKAVPSFDSLHPVTNPITSSRKLEEMDSKEQFSSFSCEDQKEVRAMSQDSNSNAAPG
KSPGDLTTSRTPRFSSPNVISFGPEQTGRALGDQSNVTGQGKKLFGSGNVAATLQRPRPA
DPMPLPAEIPPVFPSGKLGPSTNSMSGGVQTPREDWAPKPHAFVGSVKNEKTFVGGPLKA
NAENRKATGHSPLELVGHLEGMPFVMDLPFWKLPREPGKGLSEPLEPSSLPSQLSIKQAF
YGKLSKLQLSSTSFNYSSSSPTFPKGLAGSVVQLSHKANFGASHSASLSLQMFTDSSTVE
SISLQCACSLKAMIMCQGCGAFCHDDCIGPSKLCVLCLVVR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JU33	0.210	0.215	0.000	1493	0.698	0.720	A0A0G2JU33.pdb.gz	A0A0G2JU33_RAT ASXL transcriptional regulator 1 OS=Rattus norvegicus OX=10116 GN=Asxl1 PE=3 SV=2
2	AFDB:P59598	0.252	0.255	0.000	1514	0.735	0.748	P59598.pdb.gz	ASXL1_MOUSE Polycomb group protein ASXL1 OS=Mus musculus OX=10090 GN=Asxl1 PE=1 SV=1
3	AFDB:Q8IXJ9	1.000	1.000	0.000	1541	1.000	1.000	Q8IXJ9.pdb.gz	ASXL1_HUMAN Polycomb group protein ASXL1 OS=Homo sapiens OX=9606 GN=ASXL1 PE=1 SV=4
4	AFDB:Q8BZ32	0.107	0.118	1.245E-41	1370	0.267	0.300	Q8BZ32.pdb.gz	ASXL2_MOUSE Putative Polycomb group protein ASXL2 OS=Mus musculus OX=10090 GN=Asxl2 PE=1 SV=1
5	AFDB:Q76L83	0.116	0.124	3.399E-40	1435	0.275	0.295	Q76L83.pdb.gz	ASXL2_HUMAN Putative Polycomb group protein ASXL2 OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=1
6	AFDB:D3Z8N9	0.094	0.116	1.168E-31	1225	0.237	0.298	D3Z8N9.pdb.gz	D3Z8N9_RAT ASXL transcriptional regulator 2 OS=Rattus norvegicus OX=10116 GN=Asxl2 PE=3 SV=4
7	AFDB:Q9C0F0	0.132	0.097	1.698E-31	2248	0.326	0.223	Q9C0F0.pdb.gz	ASXL3_HUMAN Putative Polycomb group protein ASXL3 OS=Homo sapiens OX=9606 GN=ASXL3 PE=2 SV=3
8	AFDB:Q9V727	0.077	0.072	3.430E-18	1669	0.175	0.162	Q9V727.pdb.gz	ASX_DROME Polycomb protein Asx OS=Drosophila melanogaster OX=7227 GN=Asx PE=1 SV=1
9	AFDB:Q8MSX1	0.039	0.034	7.374E-5	1818	0.140	0.118	Q8MSX1.pdb.gz	ENC_DROME Protein encore OS=Drosophila melanogaster OX=7227 GN=enc PE=1 SV=2
10	AFDB:Q9VU86	0.031	0.028	1.072E-4	1873	0.126	0.104	Q9VU86.pdb.gz	Q9VU86_DROME LD34837p OS=Drosophila melanogaster OX=7227 GN=Spt20 PE=1 SV=3
11	PDB:3euhB	0.026	0.072	1.200	321	0.014	0.069	3euhB.pdb.gz
12	PDB:7lhwA	0.041	0.035	1.200	1813	0.008	0.007	7lhwA.pdb.gz	Structural analysis of the full-length human LRRK2.
13	PDB:6h1cB	0.035	0.322	1.857	134	0.007	0.082	6h1cB.pdb.gz	Ferric uptake regulator with Mn and Zn form Pseudomonas aeruginosa
14	PDB:6ah0u	0.044	0.214	3.060	124	0.019	0.242	6ah0u.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
15	PDB:1fx7A	0.024	0.114	3.257	230	0.008	0.052	1fx7A.pdb.gz	Crystal structure of the iron-dependent regulator from Mycobacterium tuberculosis at 2.0-A resolution reveals the Src homology domain 3-like fold and metal binding function of the third domain.
16	PDB:5khrN	0.035	0.080	3.466	645	0.008	0.019	5khrN.pdb.gz
17	PDB:6tutP	0.028	0.172	3.690	196	0.008	0.066	6tutP.pdb.gz	Structural basis for RNA polymerase III transcription repression by Maf1.
18	PDB:6labV	0.044	0.508	3.927	109	0.008	0.119	6labV.pdb.gz	Engineering nucleosomes for generating diverse chromatin assemblies.
19	PDB:7vo0G	0.040	0.360	4.180	131	0.007	0.084	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
20	PDB:2mxxA	0.026	0.108	4.449	179	0.010	0.089	2mxxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JU33	0.0	1881	1448	0.674	0.718	A0A0G2JU33_RAT ASXL transcriptional regulator 1 OS=Rattus norvegicus OX=10116 GN=Asxl1 PE=3 SV=2
2	P59598	0.0	2079	1514	0.737	0.750	ASXL1_MOUSE Polycomb group protein ASXL1 OS=Mus musculus OX=10090 GN=Asxl1 PE=1 SV=1
3	Q8IXJ9	0.0	3147	1541	1.000	1.000	ASXL1_HUMAN Polycomb group protein ASXL1 OS=Homo sapiens OX=9606 GN=ASXL1 PE=1 SV=4
4	Q9C0F0	5.47e-91	330	2248	0.124	0.085	ASXL3_HUMAN Putative Polycomb group protein ASXL3 OS=Homo sapiens OX=9606 GN=ASXL3 PE=2 SV=3
5	D3Z8N9	6.23e-61	232	1297	0.116	0.138	D3Z8N9_RAT ASXL transcriptional regulator 2 OS=Rattus norvegicus OX=10116 GN=Asxl2 PE=3 SV=4
6	A0A5F9ZHN2	1.41e-53	199	526	0.060	0.177	A0A5F9ZHN2_HUMAN ASXL transcriptional regulator 2 (Fragment) OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=1
7	Q8BZ32	1.63e-52	205	1370	0.062	0.069	ASXL2_MOUSE Putative Polycomb group protein ASXL2 OS=Mus musculus OX=10090 GN=Asxl2 PE=1 SV=1
8	E7EWD6	6.83e-52	203	1434	0.062	0.067	E7EWD6_HUMAN ASXL transcriptional regulator 2 OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=2
9	Q76L83	6.83e-52	203	1435	0.062	0.067	ASXL2_HUMAN Putative Polycomb group protein ASXL2 OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=1
10	Q9V727	6.57e-28	125	1669	0.049	0.046	ASX_DROME Polycomb protein Asx OS=Drosophila melanogaster OX=7227 GN=Asx PE=1 SV=1
11	Q14154	4.5	34.3	515	0.019	0.058	DELE1_HUMAN DAP3-binding cell death enhancer 1 OS=Homo sapiens OX=9606 GN=DELE1 PE=1 SV=3
12	Q60994	7.0	33.1	247	0.019	0.121	ADIPO_MOUSE Adiponectin OS=Mus musculus OX=10090 GN=Adipoq PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13919 ASXH	2.8e-31	119.8	Asx homology domain
2	PF05066 HARE-HTH	9.5e-15	66.1	HB1, ASXL, restriction endonuclease HTH domain
3	PF15221 LEP503	3.7e+02	12.8	Lens epithelial cell protein LEP503
4	PF13922 PHD_3	1.4e-16	71.9	PHD domain of transcriptional enhancer, Asx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364839

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417132	0.999	Ubiquitin carboxyl-terminal hydrolase BAP1
2	9606.ENSP00000320147	0.992	Histone-lysine N-methyltransferase EZH2
3	9606.ENSP00000365851	0.978	Polycomb complex protein BMI-1
4	9606.ENSP00000309555	0.972	Host cell factor 1
5	9606.ENSP00000316578	0.962	Polycomb protein SUZ12
6	9606.ENSP00000356480	0.957	E3 ubiquitin-protein ligase RING2
7	9606.ENSP00000263360	0.937	Polycomb protein EED
8	9606.ENSP00000332194	0.931	Histone H2A type 2-C
9	9606.ENSP00000473391	0.928	annotation not available
10	9606.ENSP00000441543	0.927	Polyubiquitin-C
11	9606.ENSP00000362592	0.921	Histone-binding protein RBBP4
12	9606.ENSP00000363787	0.921	E3 ubiquitin-protein ligase RING1
13	9606.ENSP00000404658	0.921	Histone-lysine N-methyltransferase EZH1
14	9606.ENSP00000442788	0.916	Methylcytosine dioxygenase TET2
15	9606.ENSP00000482063	0.913	Polycomb group RING finger protein 2
16	9606.ENSP00000308750	0.911	Chromobox protein homolog 2
17	9606.ENSP00000358862	0.907	Polycomb group RING finger protein 6
18	9606.ENSP00000430432	0.907	Histone deacetylase 2
19	9606.ENSP00000440674	0.907	Polyhomeotic-like protein 1
20	9606.ENSP00000233630	0.906	Polycomb group RING finger protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0043170	0.981	macromolecule metabolic process
GO:0019538	0.945	protein metabolic process
GO:0036211	0.943	protein modification process
GO:0065007	0.919	biological regulation
GO:0050789	0.911	regulation of biological process
GO:0009987	0.868	cellular process
GO:0050794	0.851	regulation of cellular process
GO:0048519	0.771	negative regulation of biological process
GO:0019222	0.767	regulation of metabolic process
GO:0060255	0.755	regulation of macromolecule metabolic process
GO:0080090	0.697	regulation of primary metabolic process
GO:0051171	0.680	regulation of nitrogen compound metabolic process
GO:0031323	0.667	regulation of cellular metabolic process
GO:0010468	0.654	regulation of gene expression
GO:0070647	0.641	protein modification by small protein conjugation or removal
GO:0070646	0.594	protein modification by small protein removal
GO:0009889	0.585	regulation of biosynthetic process
GO:0019219	0.577	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.565	positive regulation of biological process
GO:0031326	0.565	regulation of cellular biosynthetic process
GO:0051252	0.565	regulation of RNA metabolic process
GO:0010556	0.556	regulation of macromolecule biosynthetic process
GO:0006355	0.551	regulation of DNA-templated transcription
GO:0048523	0.499	negative regulation of cellular process
GO:0016570	0.493	histone modification
GO:0048522	0.411	positive regulation of cellular process
GO:0032502	0.336	developmental process
GO:0010604	0.333	positive regulation of macromolecule metabolic process
GO:0032501	0.308	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.997	protein-containing complex
GO:0140513	0.965	nuclear protein-containing complex
GO:0031519	0.801	PcG protein complex
GO:0005737	0.725	cytoplasm
GO:0043232	0.469	intracellular non-membrane-bounded organelle
GO:0035517	0.390	PR-DUB complex
GO:0005694	0.331	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]