StarFunc result for job id Q8IXL6

User Input

>input (584 residues)
MKMMLVRRFRVLILMVFLVACALHIALDLLPRLERRGARPSGEPGCSCAQPAAEVAAPGW
AQVRGRPGEPPAASSAAGDAGWPNKHTLRILQDFSSDPSSNLSSHSLEKLPPAAEPAERA
LRGRDPGALRPHDPAHRPLLRDPGPRRSESPPGPGGDASLLARLFEHPLYRVAVPPLTEE
DVLFNVNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAVDSYPNWLKFHIGINRYELYS
RHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIMTFQNYGQALFKPMKQTREQETPPDFF
YFSDYERHNAEIAAFHLDRILDFRRVPPVAGRMVNMTKEIRDVTRDKKLWRTFFISPANN
ICFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWE
VDPDYCEEVKQTPPYDSSHRILDVMDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNG
RGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEYKLSLLMAESLRGDQVAPVLYQ
PHLEALDRRLRVVLKAVRDCVERNGLHSVVDDDLDTEHRAASAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IXL6	1.000	1.000	7.383E-101	584	1.000	1.000	Q8IXL6.pdb.gz	FA20C_HUMAN Extracellular serine/threonine protein kinase FAM20C OS=Homo sapiens OX=9606 GN=FAM20C PE=1 SV=2
2	AFDB:Q1MTC0	0.698	0.800	7.824E-57	507	0.413	0.475	Q1MTC0.pdb.gz	Q1MTC0_DANRE Extracellular serine/threonine protein kinase FAM20C OS=Danio rerio OX=7955 GN=fam20cl PE=1 SV=1
3	AFDB:Q96MK3	0.684	0.736	1.890E-53	541	0.418	0.451	Q96MK3.pdb.gz	FA20A_HUMAN Pseudokinase FAM20A OS=Homo sapiens OX=9606 GN=FAM20A PE=1 SV=4
4	PDB:5yh3A	0.641	0.850	5.366E-48	438	0.380	0.507	5yh3A.pdb.gz	Structure and evolution of the Fam20 kinases
5	AFDB:Q9XTW2	0.578	0.658	8.343E-39	512	0.291	0.332	Q9XTW2.pdb.gz	FA20C_CAEEL Extracellular serine/threonine protein kinase CeFam20 OS=Caenorhabditis elegans OX=6239 GN=famk-1 PE=1 SV=1
6	PDB:8a5xA	0.233	0.284	2.882E-4	466	0.067	0.084	8a5xA.pdb.gz	Structure-based design and modular synthesis of novel PI4K class II inhibitors bearing a 4-aminoquinazoline scaffold.
7	PDB:4wtvB	0.230	0.304	2.458E-3	426	0.065	0.089	4wtvB.pdb.gz	The high-resolution crystal structure of phosphatidylinositol 4-kinase II beta and the crystal structure of phosphatidylinositol 4-kinase II alpha containing a nucleoside analogue provide a structural basis for isoform-specific inhibitor design.
8	PDB:5eutA	0.231	0.272	1.008E-2	485	0.068	0.082	5eutA.pdb.gz
9	PDB:5swpA	0.212	0.134	3.185E-2	1060	0.058	0.032	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
10	PDB:4ajwA	0.214	0.175	4.137E-2	765	0.060	0.046	4ajwA.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
11	PDB:6pyuA	0.220	0.153	4.593E-2	930	0.063	0.040	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
12	PDB:4ajwB	0.217	0.172	5.661E-2	792	0.060	0.044	4ajwB.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
13	PDB:7lq1A	0.211	0.145	1.006E-1	950	0.062	0.038	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
14	PDB:4wh3A	0.165	0.243	1.240E-1	356	0.065	0.107	4wh3A.pdb.gz	Open-close structural change upon ligand binding and two magnesium ions required for the catalysis of N-acetylhexosamine 1-kinase
15	AFDB:E9ADC3	0.091	0.086	4.310E-1	642	0.142	0.129	E9ADC3.pdb.gz	E9ADC3_LEIMA Choline kinase OS=Leishmania major OX=5664 GN=LMJF_27_1420 PE=4 SV=1
16	AFDB:Q84VX4	0.135	0.115	6.215E-1	777	0.103	0.077	Q84VX4.pdb.gz	MPS1_ARATH Serine/threonine-protein kinase MPS1 OS=Arabidopsis thaliana OX=3702 GN=MPS1 PE=2 SV=1
17	AFDB:F1M589	0.058	0.042	6.548E-1	886	0.077	0.051	F1M589.pdb.gz	F1M589_RAT PML nuclear body scaffold OS=Rattus norvegicus OX=10116 GN=Pml PE=1 SV=3
18	AFDB:Q967R6	0.072	0.063	6.548E-1	687	0.091	0.077	Q967R6.pdb.gz	CPEB_APLCA Cytoplasmic polyadenylation element-binding protein OS=Aplysia californica OX=6500 PE=1 SV=1
19	AFDB:D4A5D3	0.130	0.083	6.900E-1	1059	0.116	0.064	D4A5D3.pdb.gz	D4A5D3_RAT BUB1 mitotic checkpoint serine/threonine kinase OS=Rattus norvegicus OX=10116 GN=Bub1 PE=4 SV=1
20	AFDB:A0A0R4IPD5	0.056	0.043	8.072E-1	800	0.099	0.072	A0A0R4IPD5.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZV45	0.0	1046	650	0.861	0.774	A0A8I5ZV45_RAT FAM20C, golgi associated secretory pathway kinase OS=Rattus norvegicus OX=10116 GN=Fam20c PE=3 SV=1
2	B1WBN7	0.0	1048	579	0.861	0.869	B1WBN7_RAT FAM20C OS=Rattus norvegicus OX=10116 GN=Fam20c PE=2 SV=1
3	Q5MJS3	0.0	1038	579	0.865	0.872	FA20C_MOUSE Extracellular serine/threonine protein kinase FAM20C OS=Mus musculus OX=10090 GN=Fam20c PE=1 SV=1
4	Q8IXL6	0.0	1209	584	1.000	1.000	FA20C_HUMAN Extracellular serine/threonine protein kinase FAM20C OS=Homo sapiens OX=9606 GN=FAM20C PE=1 SV=2
5	B0V1R7	7.67e-169	491	502	0.413	0.480	B0V1R7_DANRE Extracellular serine/threonine protein kinase FAM20C OS=Danio rerio OX=7955 GN=fam20cl PE=1 SV=1
6	Q1MTC0	8.51e-169	491	507	0.413	0.475	Q1MTC0_DANRE Extracellular serine/threonine protein kinase FAM20C OS=Danio rerio OX=7955 GN=fam20cl PE=1 SV=1
7	A4VCL2	1.37e-144	430	528	0.351	0.388	FA20C_DROME Extracellular serine/threonine protein CG31145 OS=Drosophila melanogaster OX=7227 GN=CG31145 PE=2 SV=2
8	Q96MK3	6.28e-144	429	541	0.377	0.407	FA20A_HUMAN Pseudokinase FAM20A OS=Homo sapiens OX=9606 GN=FAM20A PE=1 SV=4
9	Q8CID3	8.78e-144	428	541	0.413	0.445	FA20A_MOUSE Pseudokinase FAM20A OS=Mus musculus OX=10090 GN=Fam20a PE=1 SV=1
10	Q9XTW2	3.96e-100	315	512	0.269	0.307	FA20C_CAEEL Extracellular serine/threonine protein kinase CeFam20 OS=Caenorhabditis elegans OX=6239 GN=famk-1 PE=1 SV=1
11	Q5RH51	2.58e-88	281	409	0.259	0.369	XYLK_DANRE Glycosaminoglycan xylosylkinase OS=Danio rerio OX=7955 GN=fam20b PE=2 SV=1
12	O75063	3.80e-87	278	409	0.243	0.347	XYLK_HUMAN Glycosaminoglycan xylosylkinase OS=Homo sapiens OX=9606 GN=FAM20B PE=1 SV=1
13	Q8VCS3	2.36e-86	276	409	0.240	0.342	XYLK_MOUSE Glycosaminoglycan xylosylkinase OS=Mus musculus OX=10090 GN=Fam20b PE=1 SV=1
14	Q95T10	9.15e-59	204	421	0.214	0.297	XYLK_DROME Glycosaminoglycan xylosylkinase homolog OS=Drosophila melanogaster OX=7227 GN=CG3631 PE=2 SV=1
15	J3KMZ0	7.6	31.6	378	0.063	0.098	J3KMZ0_HUMAN Homeobox C11 OS=Homo sapiens OX=9606 GN=HOXC11 PE=1 SV=1
16	E9PWQ3	8.4	32.0	3284	0.033	0.006	E9PWQ3_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=2
17	A0A087WS16	8.6	32.0	2677	0.033	0.007	A0A087WS16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
18	J3QQ16	8.7	32.0	2677	0.033	0.007	J3QQ16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
19	O88493	8.9	32.0	2657	0.033	0.007	O88493_MOUSE Type VI collagen alpha 3 subunit OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
20	P08120	9.6	32.0	1779	0.058	0.019	CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15051 FAM198	39	14.6	FAM198 protein
2	PF06702 Fam20C	1.6e-102	353.3	Golgi casein kinase, C-terminal, Fam20

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322323

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000468308	0.972	Pseudokinase FAM20A
2	9606.ENSP00000378517	0.812	Osteopontin
3	9606.ENSP00000229633	0.772	Histidine triad nucleotide-binding protein 3
4	9606.ENSP00000376465	0.721	Polypeptide N-acetylgalactosaminyltransferase 3
5	9606.ENSP00000354632	0.704	ATP synthase subunit a
6	9606.ENSP00000354813	0.703	NADH-ubiquinone oxidoreductase chain 5
7	9606.ENSP00000237837	0.702	Fibroblast growth factor 23
8	9606.ENSP00000273920	0.694	Enolase-phosphatase E1
9	9606.ENSP00000354728	0.689	NADH-ubiquinone oxidoreductase chain 4L
10	9606.ENSP00000354687	0.681	NADH-ubiquinone oxidoreductase chain 1
11	9606.ENSP00000355206	0.681	NADH-ubiquinone oxidoreductase chain 3
12	9606.ENSP00000355265	0.681	ATP synthase protein 8
13	9606.ENSP00000341013	0.675	Amelotin
14	9606.ENSP00000379383	0.673	Enamelin
15	9606.ENSP00000313809	0.671	Ameloblastin
16	9606.ENSP00000278572	0.662	40S ribosomal protein S3
17	9606.ENSP00000400223	0.660	Four-jointed box protein 1
18	9606.ENSP00000416984	0.657	Matrix extracellular phosphoglycoprotein
19	9606.ENSP00000354665	0.653	NADH-ubiquinone oxidoreductase chain 6
20	9606.ENSP00000304822	0.651	Kappa-casein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005515	0.996	protein binding
GO:0046872	0.987	metal ion binding
GO:0030145	0.751	manganese ion binding
GO:0019899	0.618	enzyme binding
GO:0043621	0.565	protein self-association
GO:0002020	0.557	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0006793	0.988	phosphorus metabolic process
GO:0016310	0.983	phosphorylation
GO:0071704	0.979	organic substance metabolic process
GO:0044238	0.975	primary metabolic process
GO:0006807	0.962	nitrogen compound metabolic process
GO:0043412	0.955	macromolecule modification
GO:1901564	0.931	organonitrogen compound metabolic process
GO:0009888	0.926	tissue development
GO:0019538	0.858	protein metabolic process
GO:0006468	0.806	protein phosphorylation
GO:0060563	0.717	neuroepithelial cell differentiation
GO:0065007	0.521	biological regulation
GO:0048513	0.448	animal organ development
GO:0050789	0.431	regulation of biological process
GO:0050794	0.373	regulation of cellular process
GO:0031214	0.370	biomineral tissue development
GO:0032501	0.311	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0005576	0.983	extracellular region
GO:0005615	0.936	extracellular space
GO:0016020	0.687	membrane
GO:0043233	0.530	organelle lumen
GO:0070013	0.522	intracellular organelle lumen
GO:0065010	0.487	extracellular membrane-bounded organelle
GO:0070062	0.370	extracellular exosome
GO:0000139	0.356	Golgi membrane
GO:0005783	0.335	endoplasmic reticulum
GO:0005788	0.303	endoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]