StarFunc result for job id Q8IXL7

User Input

>input (192 residues)
MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQSGSCRDKKNCKVVFSQQELRKRLTPLQYH
VTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITF
TDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSG
VASPAQADKAEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IXL7	1.000	1.000	1.746E-37	192	1.000	1.000	Q8IXL7.pdb.gz	MSRB3_HUMAN Methionine-R-sulfoxide reductase B3 OS=Homo sapiens OX=9606 GN=MSRB3 PE=1 SV=2
2	AFDB:Q5TZH8	0.725	0.744	1.600E-27	187	0.594	0.610	Q5TZH8.pdb.gz	Q5TZH8_DANRE Peptide-methionine (R)-S-oxide reductase OS=Danio rerio OX=7955 GN=wu:fc07g04 PE=3 SV=1
3	AFDB:F6P046	0.725	0.696	9.864E-27	200	0.604	0.580	F6P046.pdb.gz
4	AFDB:Q5TZH6	0.727	0.750	1.247E-26	186	0.599	0.618	Q5TZH6.pdb.gz	Q5TZH6_DANRE Peptide-methionine (R)-S-oxide reductase OS=Danio rerio OX=7955 GN=wu:fc07g04 PE=3 SV=1
5	AFDB:Q8INK9	0.678	0.627	5.027E-21	208	0.427	0.394	Q8INK9.pdb.gz	MSRB_DROME Methionine-R-sulfoxide reductase B1 OS=Drosophila melanogaster OX=7227 GN=SelR PE=1 SV=3
6	AFDB:Q9I016	0.660	0.951	5.652E-21	132	0.370	0.538	Q9I016.pdb.gz	MSRB_PSEAE Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=msrB PE=3 SV=1
7	AFDB:Q0DC89	0.642	0.578	3.285E-20	214	0.411	0.369	Q0DC89.pdb.gz	MSRB1_ORYSJ Peptide methionine sulfoxide reductase B1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=MSRB1 PE=1 SV=2
8	AFDB:Q9C8M2	0.649	0.618	8.907E-20	202	0.417	0.396	Q9C8M2.pdb.gz	MSRB1_ARATH Peptide methionine sulfoxide reductase B1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MSRB1 PE=1 SV=1
9	PDB:6symA	0.652	0.922	9.268E-20	135	0.339	0.481	6symA.pdb.gz	Structure of Peptide methionine sulfoxide reductase MsrB at 1.63 Angstrom resolution
10	AFDB:P0A746	0.655	0.915	1.126E-19	137	0.339	0.474	P0A746.pdb.gz	MSRB_ECOLI Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain K12) OX=83333 GN=msrB PE=1 SV=1
11	AFDB:Q78J03	0.629	0.689	1.601E-19	175	0.396	0.434	Q78J03.pdb.gz	MSRB2_MOUSE Methionine-R-sulfoxide reductase B2, mitochondrial OS=Mus musculus OX=10090 GN=Msrb2 PE=1 SV=1
12	PDB:2kv1A	0.371	0.533	2.999E-7	124	0.208	0.323	2kv1A.pdb.gz
13	PDB:5fqdE	0.335	0.184	1.399E-3	367	0.083	0.044	5fqdE.pdb.gz	Structural Basis of Lenalidomide-Induced Ck1Alpha Degradation by the Crl4(Crbn) Ubiquitin Ligase.
14	PDB:6h0gB	0.331	0.167	2.238E-3	401	0.078	0.037	6h0gB.pdb.gz	Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN.
15	PDB:7bkpA	0.377	0.119	1.645E-2	689	0.047	0.013	7bkpA.pdb.gz	MDA5 disease variant M854K prevents ATP-dependent structural discrimination of viral and cellular RNA.
16	PDB:6h61A	0.329	0.107	4.459E-2	660	0.052	0.015	6h61A.pdb.gz	Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.
17	PDB:7tnxA	0.354	0.118	1.528E-1	647	0.062	0.019	7tnxA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
18	PDB:8dvsA	0.348	0.111	8.378E-1	682	0.068	0.019	8dvsA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
19	PDB:5yfpH	0.135	0.062	9.990E-1	518	0.036	0.014	5yfpH.pdb.gz
20	PDB:1khiA	0.136	0.161	1.420	147	0.073	0.095	1khiA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IXL7	2.29e-143	398	192	1.000	1.000	MSRB3_HUMAN Methionine-R-sulfoxide reductase B3 OS=Homo sapiens OX=9606 GN=MSRB3 PE=1 SV=2
2	Q5TZH8	1.90e-77	231	187	0.594	0.610	Q5TZH8_DANRE Peptide-methionine (R)-S-oxide reductase OS=Danio rerio OX=7955 GN=wu:fc07g04 PE=3 SV=1
3	Q5TZH6	2.14e-77	231	186	0.562	0.581	Q5TZH6_DANRE Peptide-methionine (R)-S-oxide reductase OS=Danio rerio OX=7955 GN=wu:fc07g04 PE=3 SV=1
4	Q9C8M2	2.07e-49	160	202	0.385	0.366	MSRB1_ARATH Peptide methionine sulfoxide reductase B1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MSRB1 PE=1 SV=1
5	P0A746	1.50e-48	156	137	0.344	0.482	MSRB_ECOLI Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain K12) OX=83333 GN=msrB PE=1 SV=1
6	Q8INK9	1.91e-48	158	208	0.411	0.380	MSRB_DROME Methionine-R-sulfoxide reductase B1 OS=Drosophila melanogaster OX=7227 GN=SelR PE=1 SV=3
7	Q9I016	2.97e-48	155	132	0.365	0.530	MSRB_PSEAE Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=msrB PE=3 SV=1
8	Q0DC89	5.91e-47	155	214	0.380	0.341	MSRB1_ORYSJ Peptide methionine sulfoxide reductase B1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=MSRB1 PE=1 SV=2
9	Q78J03	2.43e-42	142	175	0.375	0.411	MSRB2_MOUSE Methionine-R-sulfoxide reductase B2, mitochondrial OS=Mus musculus OX=10090 GN=Msrb2 PE=1 SV=1
10	Q9Y3D2	1.25e-39	135	182	0.339	0.357	MSRB2_HUMAN Methionine-R-sulfoxide reductase B2, mitochondrial OS=Homo sapiens OX=9606 GN=MSRB2 PE=1 SV=2
11	P71971	2.53e-38	130	136	0.328	0.463	P71971_MYCTO peptide-methionine (R)-S-oxide reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2748 PE=4 SV=1
12	Q9C5C8	1.43e-32	117	202	0.318	0.302	MSRB2_ARATH Peptide methionine sulfoxide reductase B2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MSRB2 PE=1 SV=1
13	Q9M0Z6	2.02e-32	116	176	0.339	0.369	MSRB3_ARATH Peptide methionine sulfoxide reductase B3 OS=Arabidopsis thaliana OX=3702 GN=MSRB3 PE=2 SV=2
14	Q84JT6	1.55e-30	110	143	0.312	0.420	MSRB9_ARATH Peptide methionine sulfoxide reductase B9 OS=Arabidopsis thaliana OX=3702 GN=MSRB9 PE=2 SV=1
15	Q9Y7K1	6.67e-30	108	138	0.286	0.399	YGL4_SCHPO Uncharacterized protein C216.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC216.04c PE=3 SV=1
16	Q8VY86	2.94e-28	105	144	0.297	0.396	MSRB7_ARATH Peptide methionine sulfoxide reductase B7 OS=Arabidopsis thaliana OX=3702 GN=MSRB7 PE=2 SV=1
17	P25566	2.46e-27	103	168	0.260	0.298	MXR2_YEAST Peptide methionine sulfoxide reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MXR2 PE=1 SV=1
18	Q9NZV6	1.05e-17	77.0	116	0.208	0.345	MSRB1_HUMAN Methionine-R-sulfoxide reductase B1 OS=Homo sapiens OX=9606 GN=MSRB1 PE=1 SV=3
19	Q9JLC3	2.10e-15	70.9	116	0.203	0.336	MSRB1_MOUSE Methionine-R-sulfoxide reductase B1 OS=Mus musculus OX=10090 GN=Msrb1 PE=1 SV=3
20	A8MYR2	1.29e-05	46.2	226	0.104	0.088	A8MYR2_HUMAN L-methionine (R)-S-oxide reductase OS=Homo sapiens OX=9606 GN=MSRB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04828 GFA	83	14.9	Glutathione-dependent formaldehyde-activating enzyme
2	PF01641 SelR	7.4e-50	179.4	SelR domain
3	PF13824 zf-Mss51	1.6e+02	13.8	Zinc-finger of mitochondrial splicing suppressor 51
4	PF13248 zf-ribbon_3	39	15.1	zinc-ribbon domain
5	PF13240 zinc_ribbon_2	1.1e+02	14.0	zinc-ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347324

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313921	0.991	Mitochondrial peptide methionine sulfoxide reductase
2	9606.ENSP00000363641	0.960	Thioredoxin
3	9606.ENSP00000411584	0.761	Myb/SANT-like DNA-binding domain-containing protein 1
4	9606.ENSP00000371169	0.746	RNA 3'-terminal phosphate cyclase-like protein
5	9606.ENSP00000308369	0.739	Inner nuclear membrane protein Man1
6	9606.ENSP00000358644	0.708	Protein FAM19A3
7	9606.ENSP00000346537	0.654	SPARC-related modular calcium-binding protein 2
8	9606.ENSP00000262811	0.615	Microtubule associated serine/threonine kinase 3
9	9606.ENSP00000220966	0.612	Pyrroline-5-carboxylate reductase 3
10	9606.ENSP00000298125	0.608	WD repeat and FYVE domain-containing protein 2
11	9606.ENSP00000298386	0.603	Relaxin receptor 2
12	9606.ENSP00000262962	0.584	Part of the spliceosome which catalyzes two sequential transesterification reactions, first the excision of the non-coding intron from pre-mRNA and then the ligation of the coding exons to form the mature mRNA . Plays a role in stabilizing the structure of the spliceosome catalytic core and docking of the branch helix into the active site, producing 5'-exon and lariat intron-3'- intermediates (By similarity). May protect cells from TP53-dependent apoptosis upon dsDNA break damage through association with PRP19-CD5L complex
13	9606.ENSP00000437621	0.551	High mobility group protein HMGI-C
14	9606.ENSP00000434516	0.544	Thioredoxin reductase 1, cytoplasmic
15	9606.ENSP00000302120	0.509	Probable E3 ubiquitin-protein ligase TRIM8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0033743	1.000	peptide-methionine (R)-S-oxide reductase activity
GO:0008270	0.999	zinc ion binding
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.926	organic substance metabolic process
GO:0044238	0.918	primary metabolic process
GO:0006807	0.864	nitrogen compound metabolic process
GO:0043170	0.835	macromolecule metabolic process
GO:1901564	0.790	organonitrogen compound metabolic process
GO:0019538	0.715	protein metabolic process
GO:0009987	0.558	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005739	0.976	mitochondrion
GO:0012505	0.974	endomembrane system
GO:0005783	0.730	endoplasmic reticulum
GO:0070013	0.369	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24164	1.000	[thioredoxin]-disulfide + H2O + L-methionyl-[protein] = [thioredoxin]-dithiol + L-methionyl-(R)-S-oxide-[protein]
EC:1.8.4.12	1.000	peptide-methionine (R)-S-oxide reductase.

[back to server]