StarFunc result for job id Q8IXM2

User Input

>input (172 residues)
MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAKWTETEIEMLRAAVKRFGDD
LNHISCVIKERTVAQIKATVKRKVYEDSGIPLPAESPKKGPKKVASGVLSPPPAAPPPSS
SSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFDQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IXM2	0.999	0.999	1.064E-25	172	1.000	1.000	Q8IXM2.pdb.gz	BAP18_HUMAN Chromatin complexes subunit BAP18 OS=Homo sapiens OX=9606 GN=BAP18 PE=1 SV=1
2	AFDB:F8W1H0	0.342	0.353	1.215E-17	166	0.837	0.867	F8W1H0.pdb.gz	F8W1H0_HUMAN Chromosome 17 open reading frame 49 OS=Homo sapiens OX=9606 GN=C17orf49 PE=1 SV=1
3	AFDB:Q21021	0.258	0.075	6.737E-2	860	0.174	0.035	Q21021.pdb.gz	Q21021_CAEEL Nuclear Pore complex Protein OS=Caenorhabditis elegans OX=6239 GN=npp-9 PE=1 SV=2
4	AFDB:Q86KX8	0.241	0.038	7.235E-2	1781	0.151	0.015	Q86KX8.pdb.gz	Q86KX8_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272368 PE=4 SV=2
5	AFDB:Q1ZXN8	0.221	0.116	8.345E-2	411	0.157	0.066	Q1ZXN8.pdb.gz	Q1ZXN8_DICDI DUF1325 family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272054 PE=4 SV=1
6	AFDB:Q86G90	0.236	0.073	8.963E-2	884	0.140	0.027	Q86G90.pdb.gz	Q86G90_CAEEL Nuclear Pore complex Protein OS=Caenorhabditis elegans OX=6239 GN=npp-9 PE=1 SV=1
7	AFDB:A0A024R2J4	0.172	0.111	1.034E-1	292	0.186	0.110	A0A024R2J4.pdb.gz
8	AFDB:Q5SW24	0.189	0.066	1.110E-1	774	0.169	0.037	Q5SW24.pdb.gz	DACT2_HUMAN Dapper homolog 2 OS=Homo sapiens OX=9606 GN=DACT2 PE=1 SV=1
9	AFDB:Q15018	0.263	0.111	1.281E-1	415	0.151	0.063	Q15018.pdb.gz	ABRX2_HUMAN BRISC complex subunit Abraxas 2 OS=Homo sapiens OX=9606 GN=ABRAXAS2 PE=1 SV=2
10	AFDB:Q32MK0	0.247	0.074	1.477E-1	819	0.203	0.043	Q32MK0.pdb.gz	MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens OX=9606 GN=MYLK3 PE=1 SV=3
11	PDB:6hivCR	0.221	0.130	1.245	314	0.122	0.067	6hivCR.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
12	PDB:7cgpJ	0.171	0.322	2.541	83	0.058	0.120	7cgpJ.pdb.gz
13	PDB:7qskm	0.190	0.249	4.830	128	0.087	0.117	7qskm.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
14	PDB:7r5jW0	0.216	0.072	5.983	735	0.093	0.022	7r5jW0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
15	PDB:7qskj	0.177	0.381	6.425	71	0.058	0.141	7qskj.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
16	PDB:6ahdJ	0.191	0.147	6.901	227	0.081	0.062	6ahdJ.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
17	PDB:7qp6y	0.116	0.042	6.901	697	0.157	0.039	7qp6y.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
18	PDB:7mq8SS	0.163	0.144	7.411	197	0.093	0.081	7mq8SS.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:4v60A	0.272	0.071	7.959	812	0.145	0.031	4v60A.pdb.gz
20	PDB:4h9sA	0.177	0.306	9.180	89	0.064	0.124	4h9sA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IXM2	1.66e-122	344	172	1.000	1.000	BAP18_HUMAN Chromatin complexes subunit BAP18 OS=Homo sapiens OX=9606 GN=BAP18 PE=1 SV=1
2	H0YIS7	2.58e-116	330	233	0.953	0.704	H0YIS7_HUMAN RNASEK-C17orf49 readthrough (Fragment) OS=Homo sapiens OX=9606 GN=RNASEK-C17orf49 PE=4 SV=1
3	F8W1H0	3.05e-102	292	166	0.843	0.873	F8W1H0_HUMAN Chromosome 17 open reading frame 49 OS=Homo sapiens OX=9606 GN=C17orf49 PE=1 SV=1
4	F8W038	3.26e-95	274	157	0.797	0.873	F8W038_HUMAN Chromosome 17 open reading frame 49 OS=Homo sapiens OX=9606 GN=C17orf49 PE=1 SV=1
5	Q05GC8	0.008	38.5	1220	0.128	0.018	Q05GC8_HUMAN Breast cancer anti-estrogen resistance 2 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
6	Q96PN7	0.008	38.5	1200	0.128	0.018	TREF1_HUMAN Transcriptional-regulating factor 1 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
7	Q5RGA4	0.010	38.1	822	0.105	0.022	MYSM1_DANRE Histone H2A deubiquitinase MYSM1 OS=Danio rerio OX=7955 GN=mysm1 PE=2 SV=2
8	Q8CFE3	0.049	35.8	480	0.145	0.052	RCOR1_MOUSE REST corepressor 1 OS=Mus musculus OX=10090 GN=Rcor1 PE=1 SV=3
9	Q54R53	0.086	35.0	457	0.087	0.033	Q54R53_DICDI Myb domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=bdp1 PE=4 SV=1
10	P06876	0.14	34.7	636	0.169	0.046	MYB_MOUSE Transcriptional activator Myb OS=Mus musculus OX=10090 GN=Myb PE=1 SV=2
11	Q69Z66	0.16	34.7	819	0.081	0.017	MYSM1_MOUSE Deubiquitinase MYSM1 OS=Mus musculus OX=10090 GN=Mysm1 PE=1 SV=2
12	Q8IZ40	0.17	34.3	523	0.122	0.040	RCOR2_HUMAN REST corepressor 2 OS=Homo sapiens OX=9606 GN=RCOR2 PE=1 SV=2
13	A0A8I5ZY95	0.18	34.3	748	0.145	0.033	A0A8I5ZY95_RAT MYB proto-oncogene, transcription factor OS=Rattus norvegicus OX=10116 GN=Myb PE=4 SV=1
14	B3H5A8	0.18	34.3	372	0.233	0.108	RVE7_ARATH Protein REVEILLE 7 OS=Arabidopsis thaliana OX=3702 GN=RVE7 PE=2 SV=1
15	Q9UKL0	0.18	34.3	485	0.140	0.049	RCOR1_HUMAN REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2
16	A0A0G2K2A4	0.19	34.3	747	0.145	0.033	A0A0G2K2A4_RAT MYB proto-oncogene, transcription factor OS=Rattus norvegicus OX=10116 GN=Myb PE=1 SV=2
17	Q5FWT8	0.19	34.3	523	0.087	0.029	RCOR2_RAT REST corepressor 2 OS=Rattus norvegicus OX=10116 GN=Rcor2 PE=1 SV=1
18	Q8C796	0.19	34.3	523	0.087	0.029	RCOR2_MOUSE REST corepressor 2 OS=Mus musculus OX=10090 GN=Rcor2 PE=1 SV=1
19	A0A0G2JV86	0.20	34.3	614	0.145	0.041	A0A0G2JV86_RAT MYB proto-oncogene, transcription factor OS=Rattus norvegicus OX=10116 GN=Myb PE=1 SV=2
20	A0A8I5ZUL7	0.20	34.3	635	0.145	0.039	A0A8I5ZUL7_RAT MYB proto-oncogene, transcription factor OS=Rattus norvegicus OX=10116 GN=Myb PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00249 Myb_DNA-binding	3.9	19.1	Myb-like DNA-binding domain
2	PF13921 Myb_DNA-bind_6	71	15.1	Myb-like DNA-binding domain
3	PF15963 Myb_DNA-bind_7	0.74	21.0	Myb DNA-binding like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000009555

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000010106	0.683	Uncharacterized protein
2	9593.ENSGGOP00000000668	0.673	Actin-related protein 8
3	9593.ENSGGOP00000005254	0.507	Zinc finger, CW type with PWWP domain 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:1901363	0.883	heterocyclic compound binding
GO:0097159	0.883	organic cyclic compound binding
GO:0003676	0.856	nucleic acid binding
GO:0003677	0.788	DNA binding
GO:0043565	0.672	sequence-specific DNA binding
GO:0003690	0.658	double-stranded DNA binding
GO:1990837	0.612	sequence-specific double-stranded DNA binding
GO:0000976	0.453	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.998	regulation of macromolecule metabolic process
GO:0080090	0.997	regulation of primary metabolic process
GO:0051171	0.997	regulation of nitrogen compound metabolic process
GO:0031323	0.997	regulation of cellular metabolic process
GO:0019219	0.990	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.989	positive regulation of biological process
GO:0010556	0.986	regulation of macromolecule biosynthetic process
GO:0031326	0.985	regulation of cellular biosynthetic process
GO:0010468	0.984	regulation of gene expression
GO:2001141	0.981	regulation of RNA biosynthetic process
GO:0048522	0.975	positive regulation of cellular process
GO:0009987	0.974	cellular process
GO:0009893	0.972	positive regulation of metabolic process
GO:0006355	0.971	regulation of DNA-templated transcription
GO:0071704	0.922	organic substance metabolic process
GO:0044238	0.872	primary metabolic process
GO:0006357	0.841	regulation of transcription by RNA polymerase II
GO:0051173	0.835	positive regulation of nitrogen compound metabolic process
GO:0010604	0.833	positive regulation of macromolecule metabolic process
GO:0031325	0.810	positive regulation of cellular metabolic process
GO:0045935	0.801	positive regulation of nucleobase-containing compound metabolic process
GO:0071840	0.757	cellular component organization or biogenesis
GO:0006807	0.748	nitrogen compound metabolic process
GO:0009891	0.741	positive regulation of biosynthetic process
GO:0043170	0.734	macromolecule metabolic process
GO:0016043	0.723	cellular component organization
GO:0010557	0.603	positive regulation of macromolecule biosynthetic process
GO:0031328	0.603	positive regulation of cellular biosynthetic process
GO:0044237	0.545	cellular metabolic process
GO:0051254	0.517	positive regulation of RNA metabolic process
GO:0048519	0.516	negative regulation of biological process
GO:0045893	0.509	positive regulation of DNA-templated transcription
GO:0048523	0.447	negative regulation of cellular process
GO:0043412	0.361	macromolecule modification
GO:0010605	0.316	negative regulation of macromolecule metabolic process
GO:0006338	0.315	chromatin remodeling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.996	cytoplasm
GO:0032991	0.993	protein-containing complex
GO:0005829	0.993	cytosol
GO:0043232	0.976	intracellular non-membrane-bounded organelle
GO:1902494	0.971	catalytic complex
GO:0140513	0.971	nuclear protein-containing complex
GO:0000785	0.948	chromatin
GO:0035097	0.936	histone methyltransferase complex
GO:0044665	0.931	MLL1/2 complex
GO:0071339	0.915	MLL1 complex
GO:0070603	0.885	SWI/SNF superfamily-type complex
GO:0031010	0.713	ISWI-type complex
GO:0016589	0.360	NURF complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]