StarFunc result for job id Q8IXM7

User Input

>input (274 residues)
MKLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSCTGYIDHDIS
MFKAPAYTLHSRHSEKRMVCHSSPGPCYLLDPKITRFGMSSCPQVPMEERISNLRLNPTL
ASCQYYFEKIHPPGERRAPQYTFGYRRPYRVMDLNPAPNQYQMPLLLGPNTPVSRAAPCY
SLASRDKNWFYKEDVAGGPGPTTYARPEPSIYQNRSPTYSMAKRFAYPLDLTPRPGPGSH
EVQQVTVHKPHIPAFTMGIKHSLHLCPLVIDIRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Click to view	Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
	1	AFDB:Q8IXM7	1.000	1.000	8.518E-46	274	1.000	1.000	Q8IXM7.pdb.gz	CMA1C_HUMAN Protein CIMAP1C OS=Homo sapiens OX=9606 GN=CIMAP1C PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IXM7	0.0	566	274	1.000	1.000	CMA1C_HUMAN Protein CIMAP1C OS=Homo sapiens OX=9606 GN=CIMAP1C PE=1 SV=1
2	B3DI43	1.60e-55	181	252	0.358	0.389	B3DI43_DANRE Outer dense fiber of sperm tails 3-like 2b OS=Danio rerio OX=7955 GN=cimap1d PE=2 SV=1
3	Q3SX64	1.10e-40	144	289	0.328	0.311	CMA1D_HUMAN Protein CIMAP1D OS=Homo sapiens OX=9606 GN=CIMAP1D PE=1 SV=2
4	Q920N1	8.72e-37	132	254	0.303	0.327	CMA1A_MOUSE Ciliary microtubule associated protein 1A OS=Mus musculus OX=10090 GN=Cimap1a PE=1 SV=2
5	Q96PU9	2.15e-36	132	254	0.299	0.323	CMA1A_HUMAN Ciliary microtubule associated protein 1A OS=Homo sapiens OX=9606 GN=CIMAP1A PE=1 SV=1
6	A8MYP8	5.56e-26	104	253	0.285	0.308	CMA1B_HUMAN Ciliary microtubule associated protein 1B OS=Homo sapiens OX=9606 GN=CIMAP1B PE=1 SV=1
7	M9PCD3	9.44e-12	65.9	261	0.237	0.249	M9PCD3_DROME Uncharacterized protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
8	Q9VLQ4	2.11e-07	53.1	272	0.230	0.232	Q9VLQ4_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=2
9	Q8IPG0	2.56e-07	53.1	298	0.230	0.211	Q8IPG0_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=CG8113 PE=4 SV=1
10	M9PB71	2.95e-04	44.7	1603	0.226	0.039	M9PB71_DROME Uncharacterized protein, isoform I OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
11	M9NEC3	4.06e-04	44.3	1568	0.241	0.042	M9NEC3_DROME Uncharacterized protein, isoform H OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
12	M9NCS7	0.001	42.7	1569	0.201	0.035	M9NCS7_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
13	M9PB72	0.001	42.7	1501	0.201	0.037	M9PB72_DROME Uncharacterized protein, isoform P OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
14	M9PCJ4	0.001	42.7	1512	0.201	0.036	M9PCJ4_DROME Uncharacterized protein, isoform M OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
15	M9PCX6	0.001	42.7	1448	0.201	0.038	M9PCX6_DROME Uncharacterized protein, isoform N OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
16	M9PF71	0.001	42.7	1516	0.201	0.036	M9PF71_DROME Uncharacterized protein, isoform O OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
17	Q7KTI5	0.001	42.7	1534	0.201	0.036	Q7KTI5_DROME Uncharacterized protein, isoform L OS=Drosophila melanogaster OX=7227 GN=CG8113 PE=4 SV=3
18	Q7KTI6	0.001	42.7	1453	0.201	0.038	Q7KTI6_DROME Uncharacterized protein, isoform J OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=3
19	Q961P7	0.81	33.5	426	0.117	0.075	Q961P7_DROME GH11964p OS=Drosophila melanogaster OX=7227 GN=CG8113 PE=2 SV=1
20	Q9AUE0	3.4	32.0	1950	0.051	0.007	CALS1_ARATH Callose synthase 1 OS=Arabidopsis thaliana OX=3702 GN=CALS1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07004 SHIPPO-rpt	0.018	27.1	Sperm-tail PG-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329584

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382951	0.613	Defensin, beta 130
2	9606.ENSP00000392568	0.613	annotation not available
3	9606.ENSP00000356536	0.599	Transmembrane epididymal protein 1
4	9606.ENSP00000371847	0.556	Beta-defensin 125
5	9606.ENSP00000365024	0.544	Lymphocyte antigen 6 family member G5B
6	9606.ENSP00000383219	0.521	Keratin-associated protein 10-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.974	cellular process
GO:0032501	0.937	multicellular organismal process
GO:0032502	0.674	developmental process
GO:0000003	0.576	reproduction
GO:0065007	0.400	biological regulation
GO:0022414	0.365	reproductive process
GO:0050789	0.342	regulation of biological process
GO:0050896	0.333	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	0.998	cytoskeleton
GO:0005737	0.997	cytoplasm
GO:0043227	0.991	membrane-bounded organelle
GO:0099513	0.969	polymeric cytoskeletal fiber
GO:0043231	0.901	intracellular membrane-bounded organelle
GO:0005634	0.537	nucleus
GO:0015630	0.446	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]