StarFunc result for job id Q8IXQ3

User Input

>input (194 residues)
MAKRRAAEPVTFHVPWKRLLLCDFAEQPPPPPLWIRPPGVAHAGQLLGVPEQHRKRKIDA
GTMAEPSASPSKRRDSGDNSAPSGQEREDHGLETGDPPLPPPPVLPGPGEELPGARLPGG
GGDDGAGRAGPPRGDWGVASRQHNEEFWQYNTFQYWRNPLPPIDLADIEDLSEDTLTEAT
LQGRNEGAEVDMES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9LDL9	0.119	0.090	9.185E-1	251	0.155	0.120	Q9LDL9.pdb.gz	Q9LDL9_ARATH Activator of spomin::LUC2 OS=Arabidopsis thaliana OX=3702 GN=ASML2 PE=2 SV=1
2	AFDB:O94708	0.124	0.067	1.517	394	0.144	0.071	O94708.pdb.gz	YC58_SCHPO Uncharacterized protein C1259.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1259.08 PE=1 SV=1
3	AFDB:Q12675	0.143	0.023	2.020	1612	0.144	0.017	Q12675.pdb.gz	ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DNF2 PE=1 SV=1
4	AFDB:Q38EP5	0.142	0.111	2.170	273	0.144	0.103	Q38EP5.pdb.gz	Q38EP5_TRYB2 DNA topoisomerase type IB small subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5070 PE=4 SV=1
5	AFDB:F1M8W4	0.090	0.037	2.331	763	0.186	0.047	F1M8W4.pdb.gz	SOX5_RAT Transcription factor SOX-5 OS=Rattus norvegicus OX=10116 GN=Sox5 PE=1 SV=2
6	AFDB:Q94A32	0.105	0.089	2.690	240	0.124	0.100	Q94A32.pdb.gz	FAX2_ARATH Protein FATTY ACID EXPORT 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FAX2 PE=2 SV=1
7	AFDB:P50105	0.125	0.079	2.890	388	0.165	0.082	P50105.pdb.gz	TAF4_YEAST Transcription initiation factor TFIID subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF4 PE=1 SV=1
8	AFDB:Q6NM17	0.108	0.069	2.890	345	0.124	0.070	Q6NM17.pdb.gz	Q6NM17_ARATH At5g63050 OS=Arabidopsis thaliana OX=3702 GN=EMB2759 PE=1 SV=1
9	AFDB:Q54CK9	0.090	0.051	3.105	472	0.196	0.081	Q54CK9.pdb.gz	WASH1_DICDI WAS protein family homolog DDB_G0292878 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292878 PE=1 SV=1
10	AFDB:O43247	0.083	0.075	3.583	280	0.165	0.114	O43247.pdb.gz	CMIP4_HUMAN Ciliary microtubule inner protein 4 OS=Homo sapiens OX=9606 GN=CIMIP4 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97783	0.039	34.7	90	0.082	0.178	AF1Q_MOUSE Protein AF1q OS=Mus musculus OX=10090 GN=Mllt11 PE=1 SV=1
2	Q13015	0.100	33.5	90	0.057	0.122	AF1Q_HUMAN Protein AF1q OS=Homo sapiens OX=9606 GN=MLLT11 PE=1 SV=1
3	Q6FGF7	0.100	33.5	90	0.057	0.122	Q6FGF7_HUMAN Protein AF1q (Fragment) OS=Homo sapiens OX=9606 GN=AF1Q PE=2 SV=1
4	Q8TF05	0.25	34.3	950	0.072	0.015	PP4R1_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP4R1 PE=1 SV=1
5	F1MRS1	0.28	34.3	893	0.067	0.015	F1MRS1_BOVIN Protein phosphatase 4 regulatory subunit 1 OS=Bos taurus OX=9913 GN=PPP4R1 PE=1 SV=3
6	Q96K83	1.0	32.3	1311	0.098	0.014	ZN521_HUMAN Zinc finger protein 521 OS=Homo sapiens OX=9606 GN=ZNF521 PE=1 SV=1
7	Q92539	1.2	32.3	896	0.062	0.013	LPIN2_HUMAN Phosphatidate phosphatase LPIN2 OS=Homo sapiens OX=9606 GN=LPIN2 PE=1 SV=1
8	P43638	2.9	31.2	1398	0.082	0.011	MHP1_YEAST MAP-homologous protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MHP1 PE=1 SV=1
9	Q9BQK8	3.7	30.8	851	0.052	0.012	LPIN3_HUMAN Phosphatidate phosphatase LPIN3 OS=Homo sapiens OX=9606 GN=LPIN3 PE=1 SV=3
10	P97496	3.8	30.8	1104	0.088	0.015	SMRC1_MOUSE SWI/SNF complex subunit SMARCC1 OS=Mus musculus OX=10090 GN=Smarcc1 PE=1 SV=2
11	A0A8I5ZP90	3.9	30.8	1045	0.088	0.016	A0A8I5ZP90_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=1 SV=1
12	A0A8I6AMA8	4.2	30.4	1102	0.088	0.015	A0A8I6AMA8_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=4 SV=1
13	D3ZJU5	4.2	30.4	1078	0.088	0.016	D3ZJU5_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=1 SV=1
14	A0A0G2K9D6	4.4	30.4	1083	0.088	0.016	A0A0G2K9D6_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=1 SV=1
15	Q92922	6.4	30.0	1105	0.082	0.014	SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3
16	Q14693	7.2	30.0	890	0.067	0.015	LPIN1_HUMAN Phosphatidate phosphatase LPIN1 OS=Homo sapiens OX=9606 GN=LPIN1 PE=1 SV=2
17	P09265	7.3	29.6	410	0.139	0.066	VP16_VZVD Tegument protein VP16 homolog OS=Varicella-zoster virus (strain Dumas) OX=10338 GN=ORF10 PE=1 SV=1
18	Q5SZG1	7.6	29.3	178	0.160	0.174	Q5SZG1_HUMAN Prune exopolyphosphatase 1 (Fragment) OS=Homo sapiens OX=9606 GN=PRUNE1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15017 WRNPLPNID	0.00086	31.4	Putative WW-binding domain and destruction box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366050

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373827	0.726	Coiled-coil domain containing 150
2	9606.ENSP00000477654	0.706	Lung adenoma susceptibility protein 2
3	9606.ENSP00000366030	0.653	Carnosine N-methyltransferase
4	9606.ENSP00000418086	0.621	Uncharacterized protein C3orf14
5	9606.ENSP00000307143	0.594	Protein downstream neighbor of Son
6	9606.ENSP00000307954	0.503	Membrane protein FAM174A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.418	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.989	biological regulation
GO:0050794	0.979	regulation of cellular process
GO:0009987	0.965	cellular process
GO:0019222	0.891	regulation of metabolic process
GO:0060255	0.783	regulation of macromolecule metabolic process
GO:0048518	0.756	positive regulation of biological process
GO:0080090	0.667	regulation of primary metabolic process
GO:0051171	0.613	regulation of nitrogen compound metabolic process
GO:0048522	0.577	positive regulation of cellular process
GO:0031323	0.421	regulation of cellular metabolic process
GO:0071704	0.418	organic substance metabolic process
GO:0019219	0.389	regulation of nucleobase-containing compound metabolic process
GO:0044237	0.354	cellular metabolic process
GO:0050896	0.312	response to stimulus
GO:0071840	0.301	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.997	intracellular organelle lumen
GO:0005654	0.987	nucleoplasm
GO:0043232	0.919	intracellular non-membrane-bounded organelle
GO:0005737	0.486	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]