StarFunc result for job id Q8IXQ6

User Input

>input (854 residues)
MDFSMVAGAAAYNEKSGRITSLSLLFQKVFAQIFPQWRKGNTEECLPYKCSETGALGENY
SWQIPINHNDFKILKNNERQLCEVLQNKFGCISTLVSPVQEGNSKSLQVFRKMLTPRIEL
SVWKDDLTTHAVDAVVNAANEDLLHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEI
AVTGAGRLPCKQIIHAVGPRWMEWDKQGCTGKLQRAIVSILNYVIYKNTHIKTVAIPALS
SGIFQFPLNLCTKTIVETIRVSLQGKPMMSNLKEIHLVSNEDPTVAAFKAASEFILGKSE
LGQETTPSFNAMVVNNLTLQIVQGHIEWQTADVIVNSVNPHDITVGPVAKSILQQAGVEM
KSEFLATKAKQFQRSQLVLVTKGFNLFCKYIYHVLWHSEFPKPQILKHAMKECLEKCIEQ
NITSISFPALGTGNMEIKKETAAEILFDEVLTFAKDHVKHQLTVKFVIFPTDLEIYKAFS
SEMAKRSKMLSLNNYSVPQSTREEKRENGLEARSPAINLMGFNVEEMYEAHAWIQRILSL
QNHHIIENNHILYLGRKEHDILSQLQKTSSVSITEIISPGRTELEIEGARADLIEVVMNI
EDMLCKVQEEMARKKERGLWRSLGQWTIQQQKTQDEMKENIIFLKCPVPPTQELLDQKKQ
FEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGF
QRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGFFCQGHPLNIV
PPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFA
QHPWRGFASGSPVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CAS9	0.605	0.598	0.000	866	0.616	0.607	Q8CAS9.pdb.gz	PARP9_MOUSE Protein mono-ADP-ribosyltransferase PARP9 OS=Mus musculus OX=10090 GN=Parp9 PE=1 SV=2
2	AFDB:Q8IXQ6	1.000	1.000	0.000	854	1.000	1.000	Q8IXQ6.pdb.gz	PARP9_HUMAN Protein mono-ADP-ribosyltransferase PARP9 OS=Homo sapiens OX=9606 GN=PARP9 PE=1 SV=2
3	AFDB:Q2EMV9	0.228	0.111	1.713E-55	1817	0.260	0.122	Q2EMV9.pdb.gz	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
4	AFDB:Q460N5	0.222	0.109	3.338E-54	1801	0.285	0.135	Q460N5.pdb.gz	PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP14 OS=Homo sapiens OX=9606 GN=PARP14 PE=1 SV=3
5	AFDB:Q460N3	0.213	0.265	2.044E-43	678	0.211	0.265	Q460N3.pdb.gz	PAR15_HUMAN Protein mono-ADP-ribosyltransferase PARP15 OS=Homo sapiens OX=9606 GN=PARP15 PE=1 SV=2
6	AFDB:Q55AK6	0.209	0.113	2.292E-23	1618	0.136	0.072	Q55AK6.pdb.gz	Q55AK6_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=pARTg PE=4 SV=1
7	AFDB:E9PNI7	0.205	0.171	4.023E-19	1037	0.144	0.119	E9PNI7.pdb.gz	E9PNI7_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=1
8	AFDB:A0A0D2UG83	0.215	0.493	1.831E-15	368	0.067	0.155	A0A0D2UG83.pdb.gz	H2AY_CAPO3 Histone macroH2A1.1 OS=Capsaspora owczarzaki (strain ATCC 30864) OX=595528 GN=CAOG_004778 PE=1 SV=1
9	AFDB:Q9H0J9	0.212	0.256	1.212E-14	701	0.064	0.078	Q9H0J9.pdb.gz	PAR12_HUMAN Protein mono-ADP-ribosyltransferase PARP12 OS=Homo sapiens OX=9606 GN=PARP12 PE=1 SV=1
10	AFDB:P9WK29	0.181	0.424	1.676E-14	359	0.073	0.173	P9WK29.pdb.gz	Y1899_MYCTU Uncharacterized protein Rv1899c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1899c PE=1 SV=1
11	PDB:6fx7A	0.202	0.846	4.421E-13	194	0.067	0.294	6fx7A.pdb.gz	Crystal structure of in vitro evolved Af1521
12	PDB:5cb5R	0.192	0.897	2.627E-12	173	0.056	0.277	5cb5R.pdb.gz	Structural insights into the mechanism of Escherichia coli YmdB: A 2'-O-acetyl-ADP-ribose deacetylase
13	PDB:6y4zA	0.194	0.722	1.560E-11	221	0.056	0.217	6y4zA.pdb.gz
14	PDB:6x0lP	0.157	0.266	1.848E-5	474	0.042	0.076	6x0lP.pdb.gz	Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
15	PDB:1gytA	0.166	0.267	9.857E-5	503	0.041	0.070	1gytA.pdb.gz	X-Ray Structure of Aminopeptidase a from Escherichia Coli and a Model for the Nucleoprotein Complex in Xer Site-Specific Recombination
16	PDB:2lgrA	0.132	0.621	1.438E-4	152	0.029	0.164	2lgrA.pdb.gz
17	PDB:6lfqA	0.143	0.592	2.605E-4	169	0.029	0.148	6lfqA.pdb.gz
18	PDB:5jwqA	0.133	0.230	3.602E-4	413	0.052	0.107	5jwqA.pdb.gz	Structural basis of the day-night transition in a bacterial circadian clock.
19	PDB:4o0mA	0.112	0.162	8.545E-4	494	0.060	0.103	4o0mA.pdb.gz	An arginine tetrad as mediator of input-dependent and input-independent ATPases in the clock protein KaiC
20	PDB:4dugA	0.115	0.168	1.724E-3	506	0.049	0.083	4dugA.pdb.gz	Dephosphorylation of the Core Clock Protein KaiC in the Cyanobacterial KaiABC Circadian Oscillator Proceeds via an ATP Synthase Mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5E9U8	0.0	809	399	0.448	0.960	G5E9U8_HUMAN Poly (ADP-ribose) polymerase family, member 9, isoform CRA_b OS=Homo sapiens OX=9606 GN=PARP9 PE=1 SV=1
2	Q8CAS9	0.0	1013	866	0.621	0.612	PARP9_MOUSE Protein mono-ADP-ribosyltransferase PARP9 OS=Mus musculus OX=10090 GN=Parp9 PE=1 SV=2
3	Q8IXQ6	0.0	1779	854	1.000	1.000	PARP9_HUMAN Protein mono-ADP-ribosyltransferase PARP9 OS=Homo sapiens OX=9606 GN=PARP9 PE=1 SV=2
4	Q460N5	2.87e-61	228	1801	0.178	0.084	PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP14 OS=Homo sapiens OX=9606 GN=PARP14 PE=1 SV=3
5	Q2EMV9	8.61e-54	206	1817	0.156	0.073	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
6	Q460N3	1.92e-29	127	678	0.138	0.174	PAR15_HUMAN Protein mono-ADP-ribosyltransferase PARP15 OS=Homo sapiens OX=9606 GN=PARP15 PE=1 SV=2
7	E9PK67	2.69e-15	82.8	1016	0.060	0.050	E9PK67_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=1
8	Q53GL7	2.73e-15	82.8	1025	0.060	0.050	PAR10_HUMAN Protein mono-ADP-ribosyltransferase PARP10 OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=2
9	E9PNI7	2.91e-15	82.8	1037	0.060	0.049	E9PNI7_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=1
10	P0A8D6	4.65e-15	76.3	177	0.054	0.260	YMDB_ECOLI O-acetyl-ADP-ribose deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=ymdB PE=1 SV=1
11	Q9BQ69	1.43e-14	78.2	325	0.050	0.132	MACD1_HUMAN ADP-ribose glycohydrolase MACROD1 OS=Homo sapiens OX=9606 GN=MACROD1 PE=1 SV=2
12	Q922B1	7.73e-13	72.8	323	0.049	0.130	MACD1_MOUSE ADP-ribose glycohydrolase MACROD1 OS=Mus musculus OX=10090 GN=Macrod1 PE=1 SV=2
13	F1N973	4.23e-12	72.4	670	0.056	0.072	F1N973_CHICK TCDD inducible poly(ADP-ribose) polymerase OS=Gallus gallus OX=9031 GN=TIPARP PE=3 SV=2
14	P9WK29	4.58e-12	70.9	359	0.062	0.148	Y1899_MYCTU Uncharacterized protein Rv1899c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1899c PE=1 SV=1
15	O28751	9.24e-12	67.0	192	0.064	0.286	Y1521_ARCFU ADP-ribose glycohydrolase AF_1521 OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=AF_1521 PE=1 SV=2
16	Q8C1B2	1.24e-11	70.9	657	0.054	0.070	PARPT_MOUSE Protein mono-ADP-ribosyltransferase TIPARP OS=Mus musculus OX=10090 GN=Tiparp PE=2 SV=1
17	Q05BQ2	1.35e-11	70.5	660	0.054	0.070	Q05BQ2_HUMAN TIPARP protein (Fragment) OS=Homo sapiens OX=9606 GN=TIPARP PE=2 SV=1
18	Q7Z3E1	1.49e-11	70.5	657	0.054	0.070	PARPT_HUMAN Protein mono-ADP-ribosyltransferase TIPARP OS=Homo sapiens OX=9606 GN=TIPARP PE=1 SV=1
19	D3ZMH5	1.53e-11	70.5	657	0.054	0.070	D3ZMH5_RAT TCDD-inducible poly(ADP-ribose) polymerase OS=Rattus norvegicus OX=10116 GN=Tiparp PE=3 SV=1
20	A0A8I6GA83	1.58e-11	70.5	688	0.054	0.067	A0A8I6GA83_RAT TCDD-inducible poly(ADP-ribose) polymerase OS=Rattus norvegicus OX=10116 GN=Tiparp PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01661 Macro	2.9e-45	164.5	Macro domain
2	PF00644 PARP	0.083	24.0	Poly(ADP-ribose) polymerase catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353512

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296161	0.999	E3 ubiquitin-protein ligase DTX3L
2	9606.ENSP00000418194	0.967	Poly [ADP-ribose] polymerase 14
3	9606.ENSP00000263642	0.923	Interferon-induced helicase C domain-containing protein 1
4	9606.ENSP00000369213	0.917	Probable ATP-dependent RNA helicase DDX58
5	9606.ENSP00000263549	0.899	poly(ADP-ribose) polymerase family member 12
6	9606.ENSP00000354394	0.891	Signal transducer and activator of transcription 1-alpha/beta
7	9606.ENSP00000381601	0.854	Interferon-induced GTP-binding protein Mx1
8	9606.ENSP00000355759	0.802	Poly [ADP-ribose] polymerase 1
9	9606.ENSP00000368699	0.798	Ubiquitin-like protein ISG15
10	9606.ENSP00000371471	0.786	Radical S-adenosyl methionine domain-containing protein 2
11	9606.ENSP00000215794	0.781	Ubl carboxyl-terminal hydrolase 18
12	9606.ENSP00000359783	0.781	Interferon-induced protein 44
13	9606.ENSP00000261888	0.767	Mono [ADP-ribose] polymerase PARP16
14	9606.ENSP00000360883	0.746	Interferon-induced protein with tetratricopeptide repeats 3
15	9606.ENSP00000251642	0.745	Probable ATP-dependent RNA helicase DHX58
16	9606.ENSP00000359787	0.722	Interferon-induced protein 44-like
17	9606.ENSP00000381740	0.721	Poly [ADP-ribose] polymerase 3
18	9606.ENSP00000259030	0.719	Receptor-transporting protein 4
19	9606.ENSP00000456348	0.700	poly(ADP-ribose) polymerase family member 6
20	9606.ENSP00000333266	0.697	Ubiquitin-like modifier-activating enzyme 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901363	1.000	heterocyclic compound binding
GO:0097159	1.000	organic cyclic compound binding
GO:0043168	1.000	anion binding
GO:0042393	1.000	histone binding
GO:0003950	1.000	NAD+ ADP-ribosyltransferase activity
GO:1990404	1.000	NAD+-protein ADP-ribosyltransferase activity
GO:0003714	0.997	transcription corepressor activity
GO:0097677	0.997	STAT family protein binding
GO:0097367	0.996	carbohydrate derivative binding
GO:0004857	0.996	enzyme inhibitor activity
GO:0044389	0.995	ubiquitin-like protein ligase binding
GO:0072570	0.880	ADP-D-ribose binding
GO:0140802	0.749	NAD+-protein-C-terminal glycine ADP-ribosyltransferase activity
GO:0003676	0.346	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0019222	0.984	regulation of metabolic process
GO:0050896	0.980	response to stimulus
GO:0044238	0.979	primary metabolic process
GO:0002831	0.976	regulation of response to biotic stimulus
GO:0048584	0.976	positive regulation of response to stimulus
GO:0032101	0.975	regulation of response to external stimulus
GO:0048522	0.975	positive regulation of cellular process
GO:0031347	0.975	regulation of defense response
GO:0071704	0.974	organic substance metabolic process
GO:0060760	0.970	positive regulation of response to cytokine stimulus
GO:0002682	0.965	regulation of immune system process
GO:0001959	0.958	regulation of cytokine-mediated signaling pathway
GO:0045088	0.958	regulation of innate immune response
GO:0044237	0.953	cellular metabolic process
GO:0045089	0.951	positive regulation of innate immune response
GO:0006807	0.947	nitrogen compound metabolic process
GO:0051716	0.943	cellular response to stimulus
GO:0048519	0.943	negative regulation of biological process
GO:0060255	0.941	regulation of macromolecule metabolic process
GO:1901564	0.925	organonitrogen compound metabolic process
GO:0006950	0.897	response to stress
GO:0023056	0.896	positive regulation of signaling
GO:0009967	0.890	positive regulation of signal transduction
GO:0051171	0.888	regulation of nitrogen compound metabolic process
GO:0080090	0.881	regulation of primary metabolic process
GO:0043170	0.880	macromolecule metabolic process
GO:0048523	0.871	negative regulation of cellular process
GO:0010604	0.867	positive regulation of macromolecule metabolic process
GO:0010468	0.864	regulation of gene expression
GO:0031323	0.856	regulation of cellular metabolic process
GO:0006139	0.853	nucleobase-containing compound metabolic process
GO:0007165	0.851	signal transduction
GO:0001961	0.827	positive regulation of cytokine-mediated signaling pathway
GO:0065009	0.768	regulation of molecular function
GO:0006753	0.755	nucleoside phosphate metabolic process
GO:0009117	0.754	nucleotide metabolic process
GO:0019219	0.747	regulation of nucleobase-containing compound metabolic process
GO:0072525	0.739	pyridine-containing compound biosynthetic process
GO:0046496	0.739	nicotinamide nucleotide metabolic process
GO:0009889	0.718	regulation of biosynthetic process
GO:0010556	0.710	regulation of macromolecule biosynthetic process
GO:0031326	0.710	regulation of cellular biosynthetic process
GO:0051252	0.690	regulation of RNA metabolic process
GO:0010605	0.661	negative regulation of macromolecule metabolic process
GO:0051246	0.644	regulation of protein metabolic process
GO:0051173	0.633	positive regulation of nitrogen compound metabolic process
GO:0031325	0.633	positive regulation of cellular metabolic process
GO:0006355	0.609	regulation of DNA-templated transcription
GO:0050790	0.410	regulation of catalytic activity
GO:0051172	0.409	negative regulation of nitrogen compound metabolic process
GO:0019538	0.371	protein metabolic process
GO:0045935	0.354	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.338	regulation of transcription by RNA polymerase II
GO:0033554	0.324	cellular response to stress
GO:0043412	0.320	macromolecule modification
GO:0031399	0.313	regulation of protein modification process
GO:0019220	0.304	regulation of phosphate metabolic process
GO:0051247	0.301	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0016020	0.999	membrane
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005739	0.994	mitochondrion
GO:0032991	0.989	protein-containing complex
GO:0005694	0.935	chromosome
GO:0090734	0.863	site of DNA damage
GO:0012505	0.358	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.2.30	1.000	NAD(+) ADP-ribosyltransferase.
RHEA:58268	0.749	[protein]-C-terminal glycine + NAD(+) = [protein]-C-terminal O-(ADP-D-ribosyl)-glycine + nicotinamide

[back to server]