StarFunc result for job id Q8IXQ8

User Input

>input (264 residues)
MQKASHKNKKERGVSNKVKTSVHNLSKTQQTKLTVGSLGLGLIIIQHGPYLQITHLIRKG
AAANDGKLQPGDVLISVGHANVLGYTLREFLQLLQHITIGTVLQIKVYRDFINIPEEWQE
IYDLIPEAKFPVTSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPI
SISRDWHGYKKKNHTISVGKDINCDVMIHRDDKKEVRAPSPYWIMVKQDNESSSSSTSST
SDAFWLEDCAQVEEGKAQLVSKVG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86UL8	0.319	0.063	5.085E-10	1455	0.170	0.031	Q86UL8.pdb.gz	MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAGI2 PE=1 SV=3
2	AFDB:A0A087WT53	0.347	0.084	6.891E-10	1155	0.174	0.040	A0A087WT53.pdb.gz	A0A087WT53_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
3	AFDB:Q6RHR9	0.347	0.067	1.614E-9	1471	0.136	0.024	Q6RHR9.pdb.gz	MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Magi1 PE=1 SV=1
4	AFDB:Q96QZ7	0.329	0.064	1.715E-9	1491	0.140	0.025	Q96QZ7.pdb.gz	MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=3
5	AFDB:F1NMZ1	0.329	0.081	1.822E-9	1256	0.152	0.032	F1NMZ1.pdb.gz
6	AFDB:H7C5T8	0.329	0.091	2.058E-9	1014	0.148	0.038	H7C5T8.pdb.gz	H7C5T8_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
7	AFDB:Q5F488	0.332	0.084	2.058E-9	1128	0.114	0.027	Q5F488.pdb.gz	MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus OX=9031 GN=MAGI3 PE=2 SV=1
8	PDB:5n7dA	0.307	0.193	1.136E-8	423	0.121	0.076	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
9	AFDB:Q8VBX6	0.314	0.045	1.530E-8	2055	0.205	0.026	Q8VBX6.pdb.gz	MPDZ_MOUSE Multiple PDZ domain protein OS=Mus musculus OX=10090 GN=Mpdz PE=1 SV=2
10	AFDB:Q92796	0.310	0.105	2.203E-8	817	0.159	0.051	Q92796.pdb.gz	DLG3_HUMAN Disks large homolog 3 OS=Homo sapiens OX=9606 GN=DLG3 PE=1 SV=2
11	AFDB:A0A2R8Q8D8	0.329	0.085	2.341E-8	1081	0.129	0.031	A0A2R8Q8D8.pdb.gz
12	PDB:7pc3A	0.304	0.201	7.532E-7	405	0.114	0.074	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:7p73A	0.292	0.187	1.660E-6	420	0.087	0.055	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
14	PDB:2xkxA	0.291	0.113	3.659E-6	721	0.121	0.044	2xkxA.pdb.gz
15	PDB:7pe9I	0.283	0.238	1.321E-4	317	0.072	0.060	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
16	PDB:6t36A	0.284	0.734	2.148E-4	93	0.049	0.140	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
17	PDB:7p70A	0.295	0.195	2.426E-4	407	0.080	0.052	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
18	PDB:7pcbA	0.270	0.175	2.911E-4	415	0.068	0.043	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:7qqnC	0.280	0.182	3.945E-4	414	0.053	0.034	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:7pc5A	0.289	0.191	5.030E-4	405	0.068	0.044	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WT53	2.95e-09	59.7	1155	0.114	0.026	A0A087WT53_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
2	Q96QZ7	4.30e-09	59.3	1491	0.114	0.020	MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=3
3	Q6RHR9	4.58e-09	59.3	1471	0.114	0.020	MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Magi1 PE=1 SV=1
4	A0A8I3NPD4	4.67e-09	58.9	1398	0.114	0.021	A0A8I3NPD4_CANLF Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Canis lupus familiaris OX=9615 GN=MAGI1 PE=1 SV=1
5	H7C5T8	5.38e-09	58.9	1014	0.114	0.030	H7C5T8_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
6	H7C535	6.42e-09	58.5	1136	0.114	0.026	H7C535_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
7	A0A087WXD2	6.43e-09	58.5	980	0.114	0.031	A0A087WXD2_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
8	H7C4U7	6.48e-09	58.5	1131	0.114	0.027	H7C4U7_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
9	Q9JK71	8.38e-09	58.2	1470	0.133	0.024	MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Magi3 PE=1 SV=2
10	Q5TCQ9	1.25e-07	54.7	1481	0.110	0.020	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
11	Q9EQJ9	1.31e-07	54.7	1476	0.110	0.020	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2
12	Q86UL8	1.39e-07	54.7	1455	0.102	0.019	MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAGI2 PE=1 SV=3
13	Q9WVQ1	1.62e-07	54.3	1275	0.102	0.021	MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Mus musculus OX=10090 GN=Magi2 PE=1 SV=2
14	O88382	1.66e-07	54.3	1277	0.102	0.021	MAGI2_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Magi2 PE=1 SV=1
15	Q5F488	2.59e-07	53.9	1128	0.110	0.026	MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus OX=9031 GN=MAGI3 PE=2 SV=1
16	F1Q897	9.18e-07	52.0	1503	0.102	0.018	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
17	Q9W2L2	2.64e-05	47.8	1202	0.117	0.026	Q9W2L2_DROME LD27118p OS=Drosophila melanogaster OX=7227 GN=Magi PE=1 SV=2
18	Q9CSB4	7.17e-05	46.2	1203	0.098	0.022	PAR3L_MOUSE Partitioning defective 3 homolog B OS=Mus musculus OX=10090 GN=Pard3b PE=1 SV=2
19	A0A087WZG6	2.06e-04	44.7	1030	0.098	0.025	A0A087WZG6_HUMAN Par-3 family cell polarity regulator beta (Fragment) OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=1
20	C1P635	2.09e-04	44.7	1004	0.095	0.025	C1P635_CAEEL MAGI (Membrane Associated Guanylate kinase Inverted) homolog OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00595 PDZ	0.051	25.2	PDZ domain
2	PF13180 PDZ_2	0.033	25.9	PDZ domain
3	PF17820 PDZ_6	0.0056	27.9	PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008958217.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008965400.1	0.558	Integrator complex subunit 2
2	9597.XP_008962252.1	0.535	Calcium dependent secretion activator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0071840	0.559	cellular component organization or biogenesis
GO:0065007	0.542	biological regulation
GO:0016043	0.372	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.998	intracellular anatomical structure
GO:0043226	0.997	organelle
GO:0043227	0.989	membrane-bounded organelle
GO:0043229	0.985	intracellular organelle
GO:0016020	0.974	membrane
GO:0005737	0.948	cytoplasm
GO:0005886	0.761	plasma membrane
GO:0005829	0.758	cytosol
GO:0005634	0.639	nucleus
GO:0043228	0.451	non-membrane-bounded organelle
GO:0043232	0.368	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]