StarFunc result for job id Q8IXQ9

User Input

>input (262 residues)
MALSLGWKAHRNHCGLLLQALRSSGLLLFPCGQCPWRGAGSFLDPEIKAFLEENTEVTSS
GSLTPEIQLRLLTPRCKFWWERADLWPHSDPYWAIYWPGGQALSRYLLDNPDVVRGKSVL
DLGSGCGATAIAAKMSGASRILANDIDPIAGMAITLNCELNRLNPFPILIQNILNLEQDK
WDLVVLGDMFYDEDLADSLHQWLKKCFWTYRTRVLIGDPGRPQFSGHSIQHHLHKVVEYS
LLESTRQENSGLTTSTVWGFQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IXQ9	1.000	1.000	1.152E-57	262	1.000	1.000	Q8IXQ9.pdb.gz	ETKMT_HUMAN Electron transfer flavoprotein beta subunit lysine methyltransferase OS=Homo sapiens OX=9606 GN=ETFBKMT PE=1 SV=1
2	AFDB:Q80ZM3	0.902	0.927	1.269E-44	255	0.767	0.788	Q80ZM3.pdb.gz	ETKMT_MOUSE Electron transfer flavoprotein beta subunit lysine methyltransferase OS=Mus musculus OX=10090 GN=Mettl20 PE=1 SV=1
3	AFDB:Q7Z624	0.533	0.445	5.065E-11	323	0.172	0.139	Q7Z624.pdb.gz	CMKMT_HUMAN Calmodulin-lysine N-methyltransferase OS=Homo sapiens OX=9606 GN=CAMKMT PE=1 SV=2
4	AFDB:Q9UT28	0.536	0.549	1.193E-10	255	0.168	0.173	Q9UT28.pdb.gz	EFM7_SCHPO Protein N-terminal and lysine N-methyltransferase efm7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nnt1 PE=3 SV=1
5	AFDB:Q3U2J5	0.540	0.450	1.268E-10	323	0.156	0.127	Q3U2J5.pdb.gz	CMKMT_MOUSE Calmodulin-lysine N-methyltransferase OS=Mus musculus OX=10090 GN=Camkmt PE=1 SV=1
6	AFDB:Q05874	0.565	0.567	3.586E-10	261	0.168	0.169	Q05874.pdb.gz	EFM7_YEAST Protein N-terminal and lysine N-methyltransferase EFM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NNT1 PE=1 SV=1
7	AFDB:Q8K1A0	0.462	0.560	4.308E-10	209	0.141	0.177	Q8K1A0.pdb.gz	METL5_MOUSE rRNA N6-adenosine-methyltransferase METTL5 OS=Mus musculus OX=10090 GN=Mettl5 PE=1 SV=2
8	AFDB:F4JNX3	0.553	0.485	1.014E-9	304	0.145	0.125	F4JNX3.pdb.gz	CMKMT_ARATH Calmodulin-lysine N-methyltransferase OS=Arabidopsis thaliana OX=3702 GN=CaMKMT PE=2 SV=1
9	AFDB:Q5VZV1	0.544	0.541	1.014E-9	264	0.172	0.170	Q5VZV1.pdb.gz	MT21C_HUMAN Protein-lysine methyltransferase METTL21C OS=Homo sapiens OX=9606 GN=METTL21C PE=1 SV=1
10	AFDB:Q96AZ1	0.558	0.633	1.654E-9	226	0.168	0.195	Q96AZ1.pdb.gz	EFMT3_HUMAN EEF1A lysine methyltransferase 3 OS=Homo sapiens OX=9606 GN=EEF1AKMT3 PE=1 SV=1
11	PDB:6h2vA	0.467	0.566	2.729E-9	210	0.141	0.176	6h2vA.pdb.gz	The human 18S rRNA m6A methyltransferase METTL5 is stabilized by TRMT112.
12	PDB:3v97A	0.519	0.228	4.451E-9	667	0.122	0.048	3v97A.pdb.gz	Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA
13	PDB:4lg1A	0.508	0.598	9.857E-9	217	0.164	0.198	4lg1A.pdb.gz	The Crystal Structure of Human Methyltransferase-Like Protein 21D in Complex with SAM
14	PDB:4qpnA	0.542	0.678	1.048E-8	203	0.156	0.202	4qpnA.pdb.gz	Crystal Structure of Human Methyltransferase-Like Protein 21B
15	PDB:2bh2A	0.473	0.318	1.817E-8	418	0.122	0.077	2bh2A.pdb.gz	A Unique RNA Fold in the Ruma-RNA-Cofactor Ternary Complex Contributes to Substrate Selectivity and Enzymatic Function
16	PDB:3v97B	0.456	0.204	2.788E-8	641	0.111	0.045	3v97B.pdb.gz	Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA
17	PDB:4mtlB	0.572	0.669	2.788E-8	219	0.156	0.187	4mtlB.pdb.gz	Human Methyltransferase-Like Protein 21C
18	PDB:4lecA	0.523	0.653	2.964E-8	202	0.156	0.203	4lecA.pdb.gz	The Crystal Structure of Human Methyltransferase-Like Protein 21A in Complex with SAH
19	PDB:3cjtA	0.441	0.453	1.071E-7	254	0.134	0.138	3cjtA.pdb.gz	Multiple-Site Trimethylation of Ribosomal Protein L11 by the PrmA Methyltransferase.
20	PDB:3c0kA	0.506	0.354	1.138E-7	395	0.118	0.078	3c0kA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IXQ9	0.0	540	262	1.000	1.000	ETKMT_HUMAN Electron transfer flavoprotein beta subunit lysine methyltransferase OS=Homo sapiens OX=9606 GN=ETFBKMT PE=1 SV=1
2	Q80ZM3	5.18e-144	405	255	0.767	0.788	ETKMT_MOUSE Electron transfer flavoprotein beta subunit lysine methyltransferase OS=Mus musculus OX=10090 GN=Mettl20 PE=1 SV=1
3	Q9UT28	7.52e-07	51.2	255	0.160	0.165	EFM7_SCHPO Protein N-terminal and lysine N-methyltransferase efm7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nnt1 PE=3 SV=1
4	Q05874	4.13e-06	49.3	261	0.141	0.142	EFM7_YEAST Protein N-terminal and lysine N-methyltransferase EFM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NNT1 PE=1 SV=1
5	F4JNX3	1.55e-04	44.7	304	0.134	0.115	CMKMT_ARATH Calmodulin-lysine N-methyltransferase OS=Arabidopsis thaliana OX=3702 GN=CaMKMT PE=2 SV=1
6	O70467	0.001	42.4	528	0.107	0.053	ANM3_RAT Protein arginine N-methyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Prmt3 PE=1 SV=1
7	Q922H1	0.002	41.6	528	0.107	0.053	ANM3_MOUSE Protein arginine N-methyltransferase 3 OS=Mus musculus OX=10090 GN=Prmt3 PE=1 SV=3
8	Q9URX7	0.003	40.8	340	0.095	0.074	ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rmt1 PE=1 SV=2
9	O60678	0.004	40.4	531	0.107	0.053	ANM3_HUMAN Protein arginine N-methyltransferase 3 OS=Homo sapiens OX=9606 GN=PRMT3 PE=1 SV=4
10	Q5A943	0.005	40.0	339	0.099	0.077	Q5A943_CANAL Protein-arginine omega-N methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HMT1 PE=4 SV=1
11	Q57X10	0.007	40.0	518	0.111	0.056	Q57X10_TRYB2 tRNA (guanine(37)-N1)-methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.440 PE=3 SV=1
12	Q8BLU2	0.007	39.3	248	0.073	0.077	MT21C_MOUSE Protein-lysine methyltransferase METTL21C OS=Mus musculus OX=10090 GN=Mettl21c PE=2 SV=1
13	Q5VZV1	0.008	39.3	264	0.122	0.121	MT21C_HUMAN Protein-lysine methyltransferase METTL21C OS=Homo sapiens OX=9606 GN=METTL21C PE=1 SV=1
14	Q6NWG4	0.008	39.7	349	0.107	0.080	ANM6_DANRE Protein arginine N-methyltransferase 6 OS=Danio rerio OX=7955 GN=prmt6 PE=2 SV=2
15	Q7Q2B7	0.009	39.7	622	0.115	0.048	CARM1_ANOGA Histone-arginine methyltransferase CARMER OS=Anopheles gambiae OX=7165 GN=CARM1 PE=1 SV=5
16	Q9VH48	0.009	39.7	530	0.145	0.072	CARM1_DROME Probable histone-arginine methyltransferase CARMER OS=Drosophila melanogaster OX=7227 GN=Art4 PE=1 SV=1
17	Q8K1A0	0.011	38.5	209	0.130	0.163	METL5_MOUSE rRNA N6-adenosine-methyltransferase METTL5 OS=Mus musculus OX=10090 GN=Mettl5 PE=1 SV=2
18	Q86XA0	0.014	38.1	190	0.149	0.205	MET23_HUMAN Histone-arginine methyltransferase METTL23 OS=Homo sapiens OX=9606 GN=METTL23 PE=1 SV=3
19	Q6NZB1	0.015	38.5	378	0.084	0.058	ANM6_MOUSE Protein arginine N-methyltransferase 6 OS=Mus musculus OX=10090 GN=Prmt6 PE=1 SV=2
20	Q96LA8	0.019	38.5	375	0.122	0.085	ANM6_HUMAN Protein arginine N-methyltransferase 6 OS=Homo sapiens OX=9606 GN=PRMT6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03602 Cons_hypoth95	6.9e+02	11.3	Conserved hypothetical protein 95
2	PF10294 Methyltransf_16	1.7e-06	39.4	Lysine methyltransferase
3	PF13649 Methyltransf_25	34	16.5	Methyltransferase domain
4	PF02475 Met_10	0.35	22.1	Met-10+ like-protein
5	PF05175 MTS	0.34	22.0	Methyltransferase small domain
6	PF01135 PCMT	6.3e+02	11.5	Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
7	PF06325 PrmA	5.7e-07	40.8	Ribosomal protein L11 methyltransferase (PrmA)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350353

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346173	0.910	Electron transfer flavoprotein subunit beta
2	9606.ENSP00000357829	0.886	EEF1A lysine methyltransferase 2
3	9606.ENSP00000415115	0.881	Protein N-lysine methyltransferase METTL21A
4	9606.ENSP00000372206	0.875	EEF1A lysine methyltransferase 1
5	9606.ENSP00000379201	0.852	Protein-lysine methyltransferase METTL21D
6	9606.ENSP00000371345	0.832	Methyltransferase-like protein 22
7	9606.ENSP00000307975	0.821	Histidine protein methyltransferase 1 homolog
8	9606.ENSP00000398502	0.808	Protein-lysine N-methyltransferase EEF2KMT
9	9606.ENSP00000354920	0.801	Methyltransferase-like protein 13
10	9606.ENSP00000267273	0.783	Protein-lysine methyltransferase METTL21C
11	9606.ENSP00000454380	0.772	Protein FAM173A
12	9606.ENSP00000002125	0.768	Protein arginine methyltransferase NDUFAF7, mitochondrial
13	9606.ENSP00000368881	0.754	DNA/RNA-binding protein KIN17
14	9606.ENSP00000422338	0.754	Protein FAM173B
15	9606.ENSP00000356202	0.736	Peptide chain release factor 1-like, mitochondrial
16	9606.ENSP00000367346	0.736	Arginine-hydroxylase NDUFAF5, mitochondrial
17	9606.ENSP00000314441	0.733	tRNA (guanine-N(7)-)-methyltransferase
18	9606.ENSP00000373620	0.724	60 kDa heat shock protein, mitochondrial
19	9606.ENSP00000300209	0.718	EEF1A lysine methyltransferase 3
20	9606.ENSP00000482599	0.718	Methyltransferase-like protein 23

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016279	1.000	protein-lysine N-methyltransferase activity
GO:0031072	0.999	heat shock protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0018023	0.994	peptidyl-lysine trimethylation
GO:0046320	0.991	regulation of fatty acid oxidation
GO:0045922	0.991	negative regulation of fatty acid metabolic process
GO:0050994	0.990	regulation of lipid catabolic process
GO:0065009	0.777	regulation of molecular function
GO:0031329	0.641	regulation of cellular catabolic process
GO:0051341	0.590	regulation of oxidoreductase activity
GO:0009895	0.529	negative regulation of catabolic process
GO:0031330	0.503	negative regulation of cellular catabolic process
GO:0050995	0.354	negative regulation of lipid catabolic process
GO:0031998	0.354	regulation of fatty acid beta-oxidation
GO:0044092	0.320	negative regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005739	1.000	mitochondrion
GO:0070013	0.999	intracellular organelle lumen
GO:0005759	0.942	mitochondrial matrix
GO:0005634	0.767	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	1.000	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]