StarFunc result for job id Q8IXT1

User Input

>input (998 residues)
MNRRRKFLLASVLALQNSSFIYPSCQKCFSRIILVSKRSNCPKCGSTGESGNANYRYKLS
LKVAESNKLFVITVFGSCLDTFFGLTATGLHRYIQDPNKIPETLDNDTTQNLLTKAVETC
FVGQSFIFGVTNFENQPGQGSDASNFLQQCSDHKRKAKALVACQIVLPDPGIAGFTVIDY
FHQLLQTFNFRKLQCDSQAPNNHLLALDHSNSDLSSIYTSDSTSDFFKSCSKDTFSKFWQ
PSLEFTCIVSQLTDNDDFSASEQSKAFGTLQQNRKSISIAEATGSSSCHDPIQDSWSLVS
YMDKKSTAEKLGKELGLQAKELSAVHSSHHEIGVNDSNLFSLEMREPLESSNTKSFHSAV
EIKNRSQHELPCFQHHGIDTPTSLQKRSACCPPSLLRLEETASSSQDGDPQIWDDLPFSE
SLNKFLAVLESEIAVTQADVSSRKHHVDNDIDKFHADHSRLSVTPQRTTGALHTPPIALR
SSQVIVKANCSKDDFLFNCKGNLSPSVEKESQPDNKVEAVSVNHNGRDMSEYFLPNPYLS
ALSSSSKDLETIVTLKKTIRISPHRESDHSSLNNKYLNGCGEISVSEMNEKLTTLCYRKY
NDVSDLCKLENKQYCRWSKNQDDSFTICRKLTYPLETLCNSPNRSTNTLKEMPWGHINNN
VTQSYSIGYEGSYDASADLFDDIAKEMDIATEITKKSQDILLKWGTSLAESHPSESDFSL
RSLSEDFIQPSQKLSLQSLSDSRHSRTCSPTPHFQSDSEYNFENSQDFVPCSQSTPISGF
HQTRIHGINRAFKKPVFYSDLDGNYEKIRIFPENDKQQASPSCPKNIKTPSQKIRSPIVS
GVSQPDVFNHYPFAECHETDSDEWVPPTTQKIFPSDMLGFQGIGLGKCLAAYHFPDQQEL
PRKKLKHIRQGTNKGLIKKKLKNMLAAVVTKKKTHKYNCKSSGWISKCPDIQVLAAPQLH
PILGPDSCSEVKCCLPFSEKGPPSVCETRSAWSPELFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IXT1	0.999	0.999	0.000	998	1.000	1.000	Q8IXT1.pdb.gz	DDIAS_HUMAN DNA damage-induced apoptosis suppressor protein OS=Homo sapiens OX=9606 GN=DDIAS PE=2 SV=2
2	AFDB:Q6NZG4	0.292	0.320	3.453E-60	898	0.488	0.542	Q6NZG4.pdb.gz	DDIAS_MOUSE DNA damage-induced apoptosis suppressor protein OS=Mus musculus OX=10090 GN=Ddias PE=2 SV=1
3	PDB:7uy5I	0.107	0.184	9.588E-5	528	0.033	0.062	7uy5I.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
4	PDB:7lmaD	0.117	0.515	1.147E-4	187	0.022	0.118	7lmaD.pdb.gz	Structures of telomerase at several steps of telomere repeat synthesis.
5	PDB:7uy7A	0.110	0.184	2.216E-4	552	0.030	0.054	7uy7A.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
6	PDB:8d0bA	0.110	0.099	8.262E-4	1116	0.027	0.024	8d0bA.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
7	PDB:6w6wA	0.117	0.128	9.312E-4	905	0.028	0.031	6w6wA.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
8	PDB:6raz2	0.075	0.128	5.950E-3	559	0.017	0.030	6raz2.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
9	AFDB:A8JNK1	0.046	0.039	1.382E-2	1241	0.113	0.091	A8JNK1.pdb.gz	A8JNK1_DROME Ensconsin, isoform F OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
10	AFDB:Q9VU86	0.047	0.031	1.864E-2	1873	0.132	0.070	Q9VU86.pdb.gz	Q9VU86_DROME LD34837p OS=Drosophila melanogaster OX=7227 GN=Spt20 PE=1 SV=3
11	PDB:5v8f4	0.079	0.101	1.969E-2	741	0.023	0.031	5v8f4.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.
12	PDB:5v8f6	0.045	0.061	2.090E-2	692	0.018	0.026	5v8f6.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.
13	PDB:6raw6	0.076	0.118	2.655E-2	601	0.019	0.032	6raw6.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
14	PDB:4fdgB	0.058	0.089	2.819E-2	592	0.019	0.032	4fdgB.pdb.gz	Mini-chromosome maintenance complexes form a filament to remodel DNA structure and topology.
15	AFDB:Q9JLI2	0.045	0.034	3.007E-2	1739	0.107	0.062	Q9JLI2.pdb.gz	Q9JLI2_MOUSE Collagen type V alpha 3 chain OS=Mus musculus OX=10090 GN=Col5a3 PE=1 SV=1
16	AFDB:Q54DW1	0.054	0.041	3.390E-2	1736	0.124	0.071	Q54DW1.pdb.gz	Q54DW1_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=docC PE=3 SV=1
17	AFDB:B2RQL2	0.052	0.052	5.808E-2	990	0.128	0.129	B2RQL2.pdb.gz	STOX1_MOUSE Storkhead-box protein 1 OS=Mus musculus OX=10090 GN=Stox1 PE=1 SV=1
18	AFDB:Q8IH18	0.063	0.063	5.808E-2	1010	0.123	0.122	Q8IH18.pdb.gz	4ET_DROME Eukaryotic translation initiation factor 4E transporter OS=Drosophila melanogaster OX=7227 GN=4E-T PE=1 SV=1
19	AFDB:Q9W5E0	0.044	0.037	1.056E-1	1300	0.103	0.079	Q9W5E0.pdb.gz	SUV42_DROME Histone-lysine N-methyltransferase Suv4-20 OS=Drosophila melanogaster OX=7227 GN=Hmt4-20 PE=1 SV=1
20	AFDB:P93022	0.041	0.038	1.342E-1	1164	0.129	0.111	P93022.pdb.gz	ARFG_ARATH Auxin response factor 7 OS=Arabidopsis thaliana OX=3702 GN=ARF7 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6NZG4	0.0	867	898	0.496	0.551	DDIAS_MOUSE DNA damage-induced apoptosis suppressor protein OS=Mus musculus OX=10090 GN=Ddias PE=2 SV=1
2	Q8IXT1	0.0	2065	998	1.000	1.000	DDIAS_HUMAN DNA damage-induced apoptosis suppressor protein OS=Homo sapiens OX=9606 GN=DDIAS PE=2 SV=2
3	Q54HE3	0.027	40.8	679	0.027	0.040	Q54HE3_DICDI Replication protein A subunit OS=Dictyostelium discoideum OX=44689 GN=rfa1 PE=4 SV=1
4	Q384B5	0.96	35.8	463	0.023	0.050	Q384B5_TRYB2 Replication protein A subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0870 PE=3 SV=1
5	Q501J7	2.0	34.7	694	0.019	0.027	PHAR4_MOUSE Phosphatase and actin regulator 4 OS=Mus musculus OX=10090 GN=Phactr4 PE=1 SV=2
6	Q9S446	2.1	33.9	206	0.039	0.189	Q9S446_STAAU Class A sortase SrtA OS=Staphylococcus aureus OX=1280 GN=srtA PE=1 SV=1
7	O93526	4.6	33.1	281	0.022	0.078	FGL1L_CHICK Fibrinogen-like protein 1-like protein OS=Gallus gallus OX=9031 PE=1 SV=2
8	P91820	9.6	32.3	328	0.028	0.085	P91820_CAEEL Lateral Signaling Target OS=Caenorhabditis elegans OX=6239 GN=lst-1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10342 Kre9_KNH	4.1e+02	13.2	Kre9/KNH-like N-terminal Ig-like domain
2	PF08646 Rep_fac-A_C	0.00011	33.4	Replication factor-A C terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000435421

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380524	0.668	Calcyphosin-like protein
2	9606.ENSP00000302108	0.605	Pantothenate kinase 1
3	9606.ENSP00000323246	0.558	Transcription factor E2F7
4	9606.ENSP00000415430	0.529	G2 and S phase-expressed protein 1
5	9606.ENSP00000463334	0.526	MIF4G domain-containing protein
6	9606.ENSP00000230321	0.511	MyoD family inhibitor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.841	heterocyclic compound binding
GO:0097159	0.840	organic cyclic compound binding
GO:0003676	0.614	nucleic acid binding
GO:0003677	0.445	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0080135	0.975	regulation of cellular response to stress
GO:2001020	0.971	regulation of response to DNA damage stimulus
GO:0023051	0.930	regulation of signaling
GO:0010646	0.930	regulation of cell communication
GO:0048523	0.896	negative regulation of cellular process
GO:0009987	0.868	cellular process
GO:2001233	0.807	regulation of apoptotic signaling pathway
GO:0023057	0.797	negative regulation of signaling
GO:2001242	0.784	regulation of intrinsic apoptotic signaling pathway
GO:0043069	0.757	negative regulation of programmed cell death
GO:0010648	0.676	negative regulation of cell communication
GO:0043066	0.664	negative regulation of apoptotic process
GO:0009968	0.594	negative regulation of signal transduction
GO:1902229	0.570	regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:1902532	0.544	negative regulation of intracellular signal transduction
GO:2001234	0.544	negative regulation of apoptotic signaling pathway
GO:0050896	0.490	response to stimulus
GO:2001243	0.480	negative regulation of intrinsic apoptotic signaling pathway
GO:2001021	0.420	negative regulation of response to DNA damage stimulus
GO:0065008	0.415	regulation of biological quality
GO:0071704	0.351	organic substance metabolic process
GO:0051716	0.340	cellular response to stimulus
GO:0048522	0.336	positive regulation of cellular process
GO:0044238	0.331	primary metabolic process
GO:0044237	0.331	cellular metabolic process
GO:0006807	0.306	nitrogen compound metabolic process
GO:0019222	0.303	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.945	intracellular organelle lumen
GO:0031981	0.931	nuclear lumen
GO:0043232	0.834	intracellular non-membrane-bounded organelle
GO:0005654	0.787	nucleoplasm
GO:0005829	0.537	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]