StarFunc result for job id Q8IXT2

User Input

>input (367 residues)
MEPSDMPAGYHCPLDSAPWDETRDPQSTELIPRRAISRSPTCARCRNHGVTAHLKGHKRL
CLFQACECHKCVLILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTTQP
QVPSGKENIAPQPQTPHGAVLLAPTPPGKNSCGPLLLSHPPEASPLSWTPVPPGPWVPGH
WLPPGFSMPPPVVCRLLYQEPAVSLPPFPGFDPGTSLQLPTHGPFTTCPGSHPVLTAPLS
GEPQGPPSQPRTHSTLILQPCGTPDPLQLQPQASGASCLARTSGPSEWQLQQEAAEALVG
LKDSSQAPRVTPSVPPNPAWISLLHPCGPPAPAGGRGFQPVGPCLRPSPAPSVALHIGRL
GSISLLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IXT2	0.999	0.999	7.083E-55	367	1.000	1.000	Q8IXT2.pdb.gz	DMRTD_HUMAN Doublesex- and mab-3-related transcription factor C2 OS=Homo sapiens OX=9606 GN=DMRTC2 PE=2 SV=2
2	AFDB:Q8CGW9	0.241	0.239	4.253E-43	370	0.812	0.805	Q8CGW9.pdb.gz	DMRTD_MOUSE Doublesex- and mab-3-related transcription factor C2 OS=Mus musculus OX=10090 GN=Dmrtc2 PE=2 SV=1
3	AFDB:Q71MM5	0.181	0.247	5.324E-8	267	0.193	0.266	Q71MM5.pdb.gz	DMRT1_DANRE Doublesex- and mab-3-related transcription factor 1 OS=Danio rerio OX=7955 GN=dmrt1 PE=2 SV=1
4	AFDB:Q3LH63	0.181	0.197	5.702E-8	336	0.213	0.232	Q3LH63.pdb.gz	DMT1A_XENLA Doublesex- and mab-3-related transcription factor 1A OS=Xenopus laevis OX=8355 GN=dmrt1-a PE=1 SV=1
5	AFDB:Q80WT2	0.218	0.171	4.155E-7	476	0.256	0.197	Q80WT2.pdb.gz	DMRT3_MOUSE Doublesex- and mab-3-related transcription factor 3 OS=Mus musculus OX=10090 GN=Dmrt3 PE=2 SV=2
6	AFDB:Q9Y5R6	0.182	0.179	1.635E-6	373	0.226	0.223	Q9Y5R6.pdb.gz	DMRT1_HUMAN Doublesex- and mab-3-related transcription factor 1 OS=Homo sapiens OX=9606 GN=DMRT1 PE=1 SV=2
7	AFDB:A2A9I7	0.184	0.188	1.191E-5	359	0.232	0.237	A2A9I7.pdb.gz	DMRTB_MOUSE Doublesex- and mab-3-related transcription factor B1 OS=Mus musculus OX=10090 GN=Dmrtb1 PE=1 SV=1
8	AFDB:Q8CHU3	0.108	0.070	6.223E-2	595	0.193	0.119	Q8CHU3.pdb.gz	EPN2_MOUSE Epsin-2 OS=Mus musculus OX=10090 GN=Epn2 PE=1 SV=1
9	AFDB:P06601	0.089	0.059	8.764E-2	613	0.183	0.109	P06601.pdb.gz	PRD_DROME Segmentation protein paired OS=Drosophila melanogaster OX=7227 GN=prd PE=1 SV=1
10	AFDB:O95208	0.114	0.073	9.385E-2	641	0.204	0.117	O95208.pdb.gz	EPN2_HUMAN Epsin-2 OS=Homo sapiens OX=9606 GN=EPN2 PE=1 SV=3
11	PDB:5dgeSM	0.083	0.172	9.516	159	0.052	0.119	5dgeSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CGW9	0.0	510	370	0.812	0.805	DMRTD_MOUSE Doublesex- and mab-3-related transcription factor C2 OS=Mus musculus OX=10090 GN=Dmrtc2 PE=2 SV=1
2	Q8IXT2	0.0	722	367	1.000	1.000	DMRTD_HUMAN Doublesex- and mab-3-related transcription factor C2 OS=Homo sapiens OX=9606 GN=DMRTC2 PE=2 SV=2
3	Q8BG36	3.83e-23	102	561	0.136	0.089	DMRT2_MOUSE Doublesex- and mab-3-related transcription factor 2 OS=Mus musculus OX=10090 GN=Dmrt2 PE=1 SV=1
4	Q9Y5R5	7.60e-23	102	561	0.136	0.089	DMRT2_HUMAN Doublesex- and mab-3-related transcription factor 2 OS=Homo sapiens OX=9606 GN=DMRT2 PE=1 SV=2
5	J7FCF0	3.67e-22	97.4	300	0.117	0.143	DMR3T_HORSE Doublesex and mab-3 related transcription factor 3, truncated OS=Equus caballus OX=9796 GN=DMRT3 PE=2 SV=1
6	Q9NQL9	4.29e-22	99.4	472	0.117	0.091	DMRT3_HUMAN Doublesex- and mab-3-related transcription factor 3 OS=Homo sapiens OX=9606 GN=DMRT3 PE=1 SV=1
7	Q80WT2	4.60e-22	99.4	476	0.117	0.090	DMRT3_MOUSE Doublesex- and mab-3-related transcription factor 3 OS=Mus musculus OX=10090 GN=Dmrt3 PE=2 SV=2
8	F6W2R2	4.77e-22	99.4	474	0.117	0.091	DMRT3_HORSE Doublesex and mab-3 related transcription factor 3 OS=Equus caballus OX=9796 GN=DMRT3 PE=2 SV=2
9	P83758	6.00e-22	98.6	448	0.117	0.096	DMT3A_DANRE Doublesex- and mab-3-related transcription factor 3a OS=Danio rerio OX=7955 GN=dmrt3a PE=1 SV=2
10	A0SDZ6	1.06e-21	97.1	364	0.117	0.118	A0SDZ6_DANRE Doublesex-and mab-3-related transcription factor 2b OS=Danio rerio OX=7955 GN=dmrt2b PE=2 SV=1
11	Q9W7K3	1.06e-21	98.6	507	0.150	0.108	Q9W7K3_DANRE Doublesex and mab-3-related transcription factor 2a OS=Danio rerio OX=7955 GN=dmrt2 PE=2 SV=1
12	Q19291	1.43e-19	89.7	280	0.106	0.139	DMD5_CAEEL Doublesex- and mab-3-related transcription factor dmd-5 OS=Caenorhabditis elegans OX=6239 GN=dmd-5 PE=1 SV=2
13	Q5UU75	3.19e-19	90.9	440	0.106	0.089	DMTA2_DANRE Doublesex- and mab-3-related transcription factor A2 OS=Danio rerio OX=7955 GN=dmrta2 PE=2 SV=1
14	Q925A6	4.15e-19	89.7	374	0.104	0.102	Q925A6_RAT Doublesex and mab-3 related transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Dmrt1 PE=3 SV=1
15	Q9QZ59	4.35e-19	89.7	374	0.104	0.102	DMRT1_MOUSE Doublesex- and mab-3-related transcription factor 1 OS=Mus musculus OX=10090 GN=Dmrt1 PE=1 SV=2
16	Q2MJB4	4.57e-19	90.1	437	0.106	0.089	DMTA2_XENLA Doublesex- and mab-3-related transcription factor A2 OS=Xenopus laevis OX=8355 GN=dmrta2 PE=2 SV=1
17	Q8CFG4	5.08e-19	90.5	490	0.134	0.100	DMRTA_MOUSE Doublesex- and mab-3-related transcription factor A1 OS=Mus musculus OX=10090 GN=Dmrta1 PE=2 SV=1
18	Q9PTQ7	5.44e-19	89.4	365	0.104	0.104	DMRT1_CHICK Doublesex- and mab-3-related transcription factor 1 OS=Gallus gallus OX=9031 GN=DMRT1 PE=2 SV=2
19	Q5VZB9	5.47e-19	90.5	504	0.106	0.077	DMRTA_HUMAN Doublesex- and mab-3-related transcription factor A1 OS=Homo sapiens OX=9606 GN=DMRTA1 PE=1 SV=1
20	Q3LH63	7.09e-19	88.6	336	0.114	0.125	DMT1A_XENLA Doublesex- and mab-3-related transcription factor 1A OS=Xenopus laevis OX=8355 GN=dmrt1-a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00751 DM	2.8e-17	73.7	DM DNA binding domain
2	PF15791 DMRT-like	1.7e-47	172.2	Doublesex-and mab-3-related transcription factor C1 and C2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269945

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309189	0.615	Spermatid-associated protein
2	9606.ENSP00000453704	0.609	Homeobox protein TGIF2LX
3	9606.ENSP00000294600	0.607	Coiled-coil domain containing 27
4	9606.ENSP00000307801	0.599	Zona pellucida-like domain-containing protein 1
5	9606.ENSP00000470972	0.593	40S ribosomal protein S19
6	9606.ENSP00000476510	0.584	LY6/PLAUR domain containing 4
7	9606.ENSP00000331012	0.560	Uncharacterized protein C10orf120
8	9606.ENSP00000425786	0.522	Uncharacterized protein C4orf22
9	9606.ENSP00000371054	0.518	Insulin-like peptide INSL6
10	9606.ENSP00000340887	0.505	Uncharacterized protein C5orf47

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0005515	0.951	protein binding
GO:0042802	0.530	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0032502	0.987	developmental process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0048518	0.979	positive regulation of biological process
GO:0007276	0.977	gamete generation
GO:0009987	0.976	cellular process
GO:0048856	0.965	anatomical structure development
GO:0071704	0.962	organic substance metabolic process
GO:0048869	0.962	cellular developmental process
GO:0009893	0.961	positive regulation of metabolic process
GO:0044238	0.957	primary metabolic process
GO:0050794	0.946	regulation of cellular process
GO:0060255	0.941	regulation of macromolecule metabolic process
GO:0048232	0.940	male gamete generation
GO:0003006	0.939	developmental process involved in reproduction
GO:0080090	0.937	regulation of primary metabolic process
GO:0030154	0.931	cell differentiation
GO:0031323	0.931	regulation of cellular metabolic process
GO:0071840	0.916	cellular component organization or biogenesis
GO:0016043	0.914	cellular component organization
GO:0006807	0.911	nitrogen compound metabolic process
GO:0043170	0.906	macromolecule metabolic process
GO:0010604	0.899	positive regulation of macromolecule metabolic process
GO:0044237	0.891	cellular metabolic process
GO:0006996	0.879	organelle organization
GO:0048285	0.849	organelle fission
GO:0022412	0.848	cellular process involved in reproduction in multicellular organism
GO:0051173	0.830	positive regulation of nitrogen compound metabolic process
GO:0019538	0.807	protein metabolic process
GO:0007283	0.773	spermatogenesis
GO:0044260	0.762	cellular macromolecule metabolic process
GO:0036211	0.758	protein modification process
GO:0007127	0.753	meiosis I
GO:0051246	0.728	regulation of protein metabolic process
GO:0007141	0.672	male meiosis I
GO:0048468	0.666	cell development
GO:0008213	0.660	protein alkylation
GO:0032259	0.654	methylation
GO:0016570	0.653	histone modification
GO:0018193	0.620	peptidyl-amino acid modification
GO:0031060	0.611	regulation of histone methylation
GO:0006479	0.608	protein methylation
GO:0018205	0.561	peptidyl-lysine modification
GO:0018022	0.541	peptidyl-lysine methylation
GO:0048522	0.458	positive regulation of cellular process
GO:0016571	0.457	histone methylation
GO:0031325	0.429	positive regulation of cellular metabolic process
GO:0007281	0.406	germ cell development
GO:0010468	0.343	regulation of gene expression
GO:0006997	0.309	nucleus organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0043227	0.965	membrane-bounded organelle
GO:0005634	0.946	nucleus
GO:0005694	0.931	chromosome
GO:0000803	0.924	sex chromosome
GO:0001741	0.849	XY body
GO:0005737	0.752	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]