StarFunc result for job id Q8IY17

User Input

>input (1375 residues)
MEAPLQTGMMGTSSHGLATNSSGAKVAERDGFQDVLAPGEGSAGRICGAQPVPFVPQVLG
VMIGAGVAVVVTAVLILLVVRRLRVPKTPAPDGPRYRFRKRDKVLFYGRKIMRKVSQSTS
SLVDTSVSATSRPRMRKKLKMLNIAKKILRIQKETPTLQRKEPPPAVLEADLTEGDLANS
HLPSEVLYMLKNVRVLGHFEKPLFLELCRHMVFQRLGQGDYVFRPGQPDASIYVVQDGLL
ELCLPGPDGKECVVKEVVPGDSVNSLLSILDVITGHQHPQRTVSARAARDSTVLRLPVEA
FSAVFTKYPESLVRVVQIIMVRLQRVTFLALHNYLGLTNELFSHEIQPLRLFPSPGLPTR
TSPVRGSKRMVSTSATDEPRETPGRPPDPTGAPLPGPTGDPVKPTSLETPSAPLLSRCVS
MPGDISGLQGGPRSDFDMAYERGRISVSLQEEASGGSLAAPARTPTQEPREQPAGACEYS
YCEDESATGGCPFGPYQGRQTSSIFEAAKQELAKLMRIEDPSLLNSRVLLHHAKAGTIIA
RQGDQDVSLHFVLWGCLHVYQRMIDKAEDVCLFVAQPGELVGQLAVLTGEPLIFTLRAQR
DCTFLRISKSDFYEIMRAQPSVVLSAAHTVAARMSPFVRQMDFAIDWTAVEAGRALYRQG
DRSDCTYIVLNGRLRSVIQRGSGKKELVGEYGRGDLIGVVEALTRQPRATTVHAVRDTEL
AKLPEGTLGHIKRRYPQVVTRLIHLLSQKILGNLQQLQGPFPAGSGLGVPPHSELTNPAS
NLATVAILPVCAEVPMVAFTLELQHALQAIGPTLLLNSDIIRARLGASALDSIQEFRLSG
WLAQQEDAHRIVLYQTDASLTPWTVRCLRQADCILIVGLGDQEPTLGQLEQMLENTAVRA
LKQLVLLHREEGAGPTRTVEWLNMRSWCSGHLHLRCPRRLFSRRSPAKLHELYEKVFSRR
ADRHSDFSRLARVLTGNTIALVLGGGGARGCSHIGVLKALEEAGVPVDLVGGTSIGSFIG
ALYAEERSASRTKQRAREWAKSMTSVLEPVLDLTYPVTSMFTGSAFNRSIHRVFQDKQIE
DLWLPYFNVTTDITASAMRVHKDGSLWRYVRASMTLSGYLPPLCDPKDGHLLMDGGYINN
LPADIARSMGAKTVIAIDVGSQDETDLSTYGDSLSGWWLLWKRLNPWADKVKVPDMAEIQ
SRLAYVSCVRQLEVVKSSSYCEYLRPPIDCFKTMDFGKFDQIYDVGYQYGKAVFGGWSRG
NVIEKMLTDRRSTDLNESRRADVLAFPSSGFTDLAEIVSRIEPPTSYVSDGCADGEESDC
LTEYEEDAGPDCSRDEGGSPEGASPSTASEMEEEKSILRQRRCLPQEPPGSATDA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AJ88	0.775	0.788	0.000	1352	0.595	0.605	A2AJ88.pdb.gz	PLPL7_MOUSE Patatin-like phospholipase domain-containing protein 7 OS=Mus musculus OX=10090 GN=Pnpla7 PE=1 SV=1
2	AFDB:Q8IY17	1.000	1.000	0.000	1375	1.000	1.000	Q8IY17.pdb.gz	PLPL6_HUMAN Patatin-like phospholipase domain-containing protein 6 OS=Homo sapiens OX=9606 GN=PNPLA6 PE=1 SV=3
3	AFDB:Q9USJ4	0.603	0.629	6.368E-83	1316	0.267	0.279	Q9USJ4.pdb.gz	NTE1_SCHPO Lysophospholipase NTE1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nte1 PE=3 SV=1
4	AFDB:P9WIY7	0.314	0.675	1.128E-32	583	0.100	0.237	P9WIY7.pdb.gz	Y2565_MYCTU Uncharacterized NTE family protein Rv2565 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2565 PE=1 SV=1
5	AFDB:Q8MVR1	0.091	0.051	2.426E-16	2631	0.075	0.039	Q8MVR1.pdb.gz	GBPC_DICDI Cyclic GMP-binding protein C OS=Dictyostelium discoideum OX=44689 GN=gbpC PE=1 SV=1
6	PDB:5dykA	0.092	0.141	5.293E-14	809	0.057	0.098	5dykA.pdb.gz
7	PDB:3j4qB	0.080	0.256	5.855E-14	382	0.041	0.149	3j4qB.pdb.gz
8	PDB:6byrB	0.082	0.319	3.987E-13	288	0.039	0.188	6byrB.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
9	PDB:4dinB	0.081	0.277	9.891E-13	345	0.043	0.171	4dinB.pdb.gz	Localization and quaternary structure of the PKA RI Beta holoenzyme
10	PDB:4f7zA	0.081	0.114	6.403E-12	946	0.048	0.070	4f7zA.pdb.gz
11	PDB:2byvE	0.080	0.115	1.589E-11	922	0.047	0.070	2byvE.pdb.gz
12	PDB:6wjfC	0.078	0.315	6.137E-9	295	0.039	0.180	6wjfC.pdb.gz
13	PDB:3i54D	0.090	0.482	3.778E-8	228	0.021	0.127	3i54D.pdb.gz	Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
14	AFDB:Q79VI7	0.083	0.474	4.247E-8	227	0.019	0.115	Q79VI7.pdb.gz	CRPL_CORGL CRP-like cAMP-activated global transcriptional regulator OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=glxR PE=1 SV=1
15	PDB:6aunA	0.154	0.320	9.857E-8	618	0.037	0.083	6aunA.pdb.gz
16	PDB:3dkwA	0.092	0.478	1.334E-7	227	0.017	0.101	3dkwA.pdb.gz
17	AFDB:A0R5H1	0.088	0.498	3.539E-7	224	0.016	0.098	A0R5H1.pdb.gz	A0R5H1_MYCS2 Transcriptional regulator, Crp/Fnr family protein OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_6189 PE=4 SV=1
18	AFDB:Q9UQ05	0.084	0.112	3.431E-6	1017	0.055	0.074	Q9UQ05.pdb.gz	KCNH4_HUMAN Potassium voltage-gated channel subfamily H member 4 OS=Homo sapiens OX=9606 GN=KCNH4 PE=2 SV=1
19	AFDB:Q96L42	0.081	0.099	9.416E-6	1107	0.045	0.056	Q96L42.pdb.gz	KCNH8_HUMAN Potassium voltage-gated channel subfamily H member 8 OS=Homo sapiens OX=9606 GN=KCNH8 PE=2 SV=2
20	AFDB:Q8BX90	0.039	0.043	1.126E-1	1198	0.041	0.047	Q8BX90.pdb.gz	FND3A_MOUSE Fibronectin type-III domain-containing protein 3A OS=Mus musculus OX=10090 GN=Fndc3a PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384DVU0	0.0	2792	1365	0.993	1.000	A0A384DVU0_HUMAN Patatin like phospholipase domain containing 6 OS=Homo sapiens OX=9606 GN=PNPLA6 PE=1 SV=1
2	A2AJ88	0.0	1590	1352	0.598	0.608	PLPL7_MOUSE Patatin-like phospholipase domain-containing protein 7 OS=Mus musculus OX=10090 GN=Pnpla7 PE=1 SV=1
3	F1R844	0.0	1951	1342	0.711	0.728	F1R844_DANRE Neuropathy target esterase isoform X3 OS=Danio rerio OX=7955 GN=pnpla6 PE=3 SV=1
4	Q3TRM4	0.0	2618	1355	0.940	0.954	PLPL6_MOUSE Patatin-like phospholipase domain-containing protein 6 OS=Mus musculus OX=10090 GN=Pnpla6 PE=1 SV=2
5	Q5BK26	0.0	1576	1349	0.583	0.595	PLPL7_RAT Patatin-like phospholipase domain-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Pnpla7 PE=1 SV=2
6	Q8IY17	0.0	2815	1375	1.000	1.000	PLPL6_HUMAN Patatin-like phospholipase domain-containing protein 6 OS=Homo sapiens OX=9606 GN=PNPLA6 PE=1 SV=3
7	Q9U969	0.0	1033	1425	0.407	0.392	SWS_DROME Neuropathy target esterase sws OS=Drosophila melanogaster OX=7227 GN=sws PE=1 SV=2
8	Q9USJ4	1.54e-148	487	1316	0.208	0.217	NTE1_SCHPO Lysophospholipase NTE1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nte1 PE=3 SV=1
9	Q04958	2.42e-136	460	1679	0.190	0.155	NTE1_YEAST Lysophospholipase NTE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTE1 PE=1 SV=1
10	P9WIY7	4.93e-27	120	583	0.050	0.118	Y2565_MYCTU Uncharacterized NTE family protein Rv2565 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2565 PE=1 SV=1
11	Q9HYQ6	1.09e-22	107	728	0.068	0.128	Q9HYQ6_PSEAE Patatin-like protein, PlpD OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=plpD PE=1 SV=1
12	P07278	8.58e-07	55.5	416	0.034	0.113	KAPR_YEAST cAMP-dependent protein kinase regulatory subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BCY1 PE=1 SV=4
13	P05987	2.86e-06	53.5	327	0.035	0.147	KAPR_DICDI cAMP-dependent protein kinase regulatory subunit OS=Dictyostelium discoideum OX=44689 GN=pkaR PE=1 SV=1
14	P81900	4.64e-05	49.7	377	0.045	0.164	KAPR2_DROME cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R2 PE=1 SV=2
15	P16905	6.73e-05	49.3	376	0.036	0.133	KAPR1_DROME cAMP-dependent protein kinase type I regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R1 PE=1 SV=2
16	Q9Y827	9.31e-05	49.3	483	0.018	0.052	TGL5_SCHPO Triacylglycerol lipase ptl3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptl3 PE=3 SV=1
17	Q5E593	1.02e-04	47.8	250	0.017	0.092	Q5E593_ALIF1 Transcriptional regulatory protein Fnr, global regulator of anaerobic growth OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=fnr PE=4 SV=2
18	P00514	1.18e-04	48.5	380	0.036	0.129	KAP0_BOVIN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR1A PE=1 SV=2
19	P09456	1.50e-04	48.1	381	0.035	0.126	KAP0_RAT cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar1a PE=1 SV=2
20	P31321	1.52e-04	48.1	381	0.044	0.157	KAP1_HUMAN cAMP-dependent protein kinase type I-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1B PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	5.2e-48	172.4	Cyclic nucleotide-binding domain
2	PF01734 Patatin	9.3e-20	83.2	Patatin-like phospholipase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000407509

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368305	0.942	Glycerophosphocholine phosphodiesterase GPCPD1
2	9606.ENSP00000264005	0.926	Phosphatidylcholine-sterol acyltransferase
3	9606.ENSP00000219345	0.925	Group XV phospholipase A2
4	9606.ENSP00000320337	0.909	HRAS-like suppressor 3
5	9606.ENSP00000333142	0.864	85/88 kDa calcium-independent phospholipase A2
6	9606.ENSP00000410804	0.856	Calcium-independent phospholipase A2-gamma
7	9606.ENSP00000363638	0.855	Acyl-protein thioesterase 2
8	9606.ENSP00000320043	0.853	Acyl-protein thioesterase 1
9	9606.ENSP00000384610	0.840	Patatin-like phospholipase domain-containing protein 7
10	9606.ENSP00000330442	0.834	Phospholipase B1, membrane-associated
11	9606.ENSP00000371886	0.795	JMJD7-PLA2G4B readthrough
12	9606.ENSP00000472546	0.775	Cytosolic phospholipase A2 gamma
13	9606.ENSP00000414147	0.771	Spartin
14	9606.ENSP00000396045	0.769	Cytosolic phospholipase A2 beta
15	9606.ENSP00000290472	0.767	Cytosolic phospholipase A2 delta
16	9606.ENSP00000383364	0.765	Phospholipase A2, membrane associated
17	9606.ENSP00000356436	0.759	Cytosolic phospholipase A2
18	9606.ENSP00000382434	0.754	Cytosolic phospholipase A2 epsilon
19	9606.ENSP00000264079	0.749	Mucolipin-1
20	9606.ENSP00000355675	0.748	Gap junction gamma-2 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004622	1.000	lysophospholipase activity
GO:0005488	0.775	binding
GO:0005515	0.387	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0044238	0.989	primary metabolic process
GO:0046486	0.961	glycerolipid metabolic process
GO:0019637	0.952	organophosphate metabolic process
GO:0006650	0.935	glycerophospholipid metabolic process
GO:0009056	0.924	catabolic process
GO:1901575	0.907	organic substance catabolic process
GO:0016042	0.902	lipid catabolic process
GO:0044248	0.884	cellular catabolic process
GO:0044242	0.825	cellular lipid catabolic process
GO:0046434	0.806	organophosphate catabolic process
GO:0046503	0.698	glycerolipid catabolic process
GO:0009395	0.457	phospholipid catabolic process
GO:0046475	0.453	glycerophospholipid catabolic process
GO:0032502	0.377	developmental process
GO:0032501	0.373	multicellular organismal process
GO:0006807	0.369	nitrogen compound metabolic process
GO:0048856	0.364	anatomical structure development
GO:0007275	0.324	multicellular organism development
GO:0050789	0.319	regulation of biological process
GO:1901564	0.304	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.994	cytosol
GO:0005783	0.989	endoplasmic reticulum
GO:0031984	0.973	organelle subcompartment
GO:0031090	0.971	organelle membrane
GO:0098827	0.930	endoplasmic reticulum subcompartment
GO:0005789	0.911	endoplasmic reticulum membrane
GO:0070013	0.341	intracellular organelle lumen
GO:0005634	0.305	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15177	1.000	a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine
EC:3.1.1.5	1.000	lysophospholipase.

[back to server]