StarFunc result for job id Q8IY18

User Input

>input (1101 residues)
MATPSKKTSTPSPQPSKRALPRDPSSEVPSKRKNSAPQLPLLQSSGPFVEGSIVRISMEN
FLTYDICEVSPGPHLNMIVGANGTGKSSIVCAICLGLAGKPAFMGRADKVGFFVKRGCSR
GMVEIELFRASGNLVITREIDVAKNQSFWFINKKSTTQKIVEEKVAALNIQVGNLCQFLP
QDKVGEFAKLSKIELLEATEKSIGPPEMHKYHCELKNLREKEKQLETSCKEKTEYLQKMV
QRNERYKQDVERFYERKRHLDLIEMLEAKRPWVEYENVRQEYEEVKLVRDRVKEEVRKLK
EGQIPVTCRIEEMENERHNLEARIKEKATDIKEASQKCKQKQDVIERKDKHIEELQQALI
VKQNEELDRQRRIGNTRKMIEDLQNELKTTENCENLQPQIDAITNDLRRIQDEKALCEGE
IIDKRRERETLEKEKKSVDDHIVRFDNLMNQKEDKLRQRFRDTYDAVLWLRNNRDKFKQR
VCEPIMLTINMKDNKNAKYIENHIPSNDLRAFVFESQEDMEVFLKEVRDNKKLRVNAVIA
PKSSYADKAPSRSLNELKQYGFFSYLRELFDAPDPVMSYLCCQYHIHEVPVGTEKTRERI
ERVIQETRLKQIYTAEEKYVVKTSFYSNKVISSNTSLKVAQFLTVTVDLEQRRHLEEQLK
EIHRKLQAVDSGLIALRETSKHLEHKDNELRQKKKELLERKTKKRQLEQKISSKLGSLKL
MEQDTCNLEEEERKASTKIKEINVQKAKLVTELTNLIKICTSLHIQKVDLILQNTTVISE
KNKLESDYMAASSQLRLTEQHFIELDENRQRLLQKCKELMKRARQVCNLGAEQTLPQEYQ
TQVPTIPNGHNSSLPMVFQDLPNTLDEIDALLTEERSRASCFTGLNPTIVQEYTKREEEI
EQLTEELKGKKVELDQYRENISQVKERWLNPLKELVEKINEKFSNFFSSMQCAGEVDLHT
ENEEDYDKYGIRIRVKFRSSTQLHELTPHHQSGGERSVSTMLYLMALQELNRCPFRVVDE
INQGMDPINERRVFEMVVNTACKENTSQYFFITPKLLQNLPYSEKMTVLFVYNGPHMLEP
NTWNLKAFQRRRRRITFTQPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CG46	0.656	0.656	0.000	1101	0.894	0.894	Q8CG46.pdb.gz	SMC5_MOUSE Structural maintenance of chromosomes protein 5 OS=Mus musculus OX=10090 GN=Smc5 PE=1 SV=1
2	AFDB:Q8IY18	1.000	1.000	0.000	1101	1.000	1.000	Q8IY18.pdb.gz	SMC5_HUMAN Structural maintenance of chromosomes protein 5 OS=Homo sapiens OX=9606 GN=SMC5 PE=1 SV=2
3	AFDB:Q9LFS8	0.492	0.512	5.116E-77	1053	0.289	0.302	Q9LFS8.pdb.gz	SMC5_ARATH Structural maintenance of chromosomes protein 5 OS=Arabidopsis thaliana OX=3702 GN=SMC5 PE=2 SV=1
4	AFDB:Q7KTV9	0.416	0.456	5.826E-69	1001	0.246	0.271	Q7KTV9.pdb.gz	Q7KTV9_DROME Structural maintenance of chromosomes protein 5 OS=Drosophila melanogaster OX=7227 GN=SMC5 PE=1 SV=2
5	AFDB:O13710	0.436	0.444	4.267E-68	1076	0.247	0.253	O13710.pdb.gz	SMC5_SCHPO Structural maintenance of chromosomes protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smc5 PE=1 SV=3
6	AFDB:Q7YU66	0.409	0.434	2.055E-67	1034	0.244	0.260	Q7YU66.pdb.gz	Q7YU66_DROME Structural maintenance of chromosomes protein 5 OS=Drosophila melanogaster OX=7227 GN=SMC5 PE=2 SV=1
7	AFDB:Q08204	0.364	0.367	1.506E-66	1093	0.257	0.259	Q08204.pdb.gz	SMC5_YEAST Structural maintenance of chromosomes protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC5 PE=1 SV=1
8	AFDB:Q18237	0.274	0.279	3.879E-65	1076	0.245	0.251	Q18237.pdb.gz	SMC5_CAEEL Structural maintenance of chromosomes protein 5 OS=Caenorhabditis elegans OX=6239 GN=smc-5 PE=1 SV=2
9	AFDB:Q59UE8	0.363	0.372	3.916E-62	1073	0.229	0.235	Q59UE8.pdb.gz	Q59UE8_CANAL Structural maintenance of chromosomes protein 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SMC5 PE=3 SV=1
10	PDB:7qcdA	0.346	0.368	1.363E-51	1028	0.252	0.269	7qcdA.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
11	AFDB:Q924W5	0.275	0.276	7.326E-46	1097	0.173	0.173	Q924W5.pdb.gz	SMC6_MOUSE Structural maintenance of chromosomes protein 6 OS=Mus musculus OX=10090 GN=Smc6 PE=1 SV=1
12	PDB:6yvuB	0.262	0.244	3.558E-29	1191	0.153	0.141	6yvuB.pdb.gz
13	PDB:7qcdB	0.303	0.329	3.773E-27	998	0.144	0.159	7qcdB.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
14	PDB:7tveE	0.281	0.654	1.152E-21	461	0.173	0.414	7tveE.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
15	PDB:6yvuA	0.222	0.217	2.672E-20	1127	0.154	0.151	6yvuA.pdb.gz
16	PDB:6wg3B	0.236	0.360	2.089E-15	693	0.118	0.188	6wg3B.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
17	PDB:6wg3A	0.231	0.437	5.976E-14	561	0.097	0.191	6wg3A.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
18	PDB:7tveD	0.134	0.318	3.062E-10	445	0.045	0.110	7tveD.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
19	PDB:7ogtB	0.203	0.294	3.400E-10	708	0.084	0.131	7ogtB.pdb.gz
20	PDB:7qenB	0.157	0.389	1.077E-9	419	0.047	0.124	7qenB.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CG46	0.0	2061	1101	0.895	0.895	SMC5_MOUSE Structural maintenance of chromosomes protein 5 OS=Mus musculus OX=10090 GN=Smc5 PE=1 SV=1
2	Q8IY18	0.0	2266	1101	1.000	1.000	SMC5_HUMAN Structural maintenance of chromosomes protein 5 OS=Homo sapiens OX=9606 GN=SMC5 PE=1 SV=2
3	Q9LFS8	1.93e-152	484	1053	0.320	0.334	SMC5_ARATH Structural maintenance of chromosomes protein 5 OS=Arabidopsis thaliana OX=3702 GN=SMC5 PE=2 SV=1
4	Q7YU66	3.31e-116	386	1034	0.274	0.292	Q7YU66_DROME Structural maintenance of chromosomes protein 5 OS=Drosophila melanogaster OX=7227 GN=SMC5 PE=2 SV=1
5	Q8IPT2	4.40e-116	386	1034	0.274	0.292	Q8IPT2_DROME Structural maintenance of chromosomes protein 5 OS=Drosophila melanogaster OX=7227 GN=SMC5 PE=1 SV=3
6	Q7KTV9	2.46e-114	380	1001	0.275	0.303	Q7KTV9_DROME Structural maintenance of chromosomes protein 5 OS=Drosophila melanogaster OX=7227 GN=SMC5 PE=1 SV=2
7	M9PGC9	6.69e-109	366	1025	0.270	0.290	M9PGC9_DROME Structural maintenance of chromosomes protein 5 OS=Drosophila melanogaster OX=7227 GN=SMC5 PE=1 SV=1
8	Q9VP12	4.96e-107	360	992	0.268	0.297	Q9VP12_DROME Structural maintenance of chromosomes protein 5 OS=Drosophila melanogaster OX=7227 GN=SMC5 PE=1 SV=3
9	Q8T386	5.21e-105	355	1030	0.278	0.297	Q8T386_DROME Structural maintenance of chromosomes protein 5 OS=Drosophila melanogaster OX=7227 GN=SMC5 PE=2 SV=1
10	Q18237	2.46e-101	346	1076	0.277	0.283	SMC5_CAEEL Structural maintenance of chromosomes protein 5 OS=Caenorhabditis elegans OX=6239 GN=smc-5 PE=1 SV=2
11	O13710	4.22e-100	343	1076	0.289	0.296	SMC5_SCHPO Structural maintenance of chromosomes protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smc5 PE=1 SV=3
12	Q08204	7.42e-38	156	1093	0.078	0.079	SMC5_YEAST Structural maintenance of chromosomes protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC5 PE=1 SV=1
13	Q59UE8	2.10e-31	135	1073	0.061	0.062	Q59UE8_CANAL Structural maintenance of chromosomes protein 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SMC5 PE=3 SV=1
14	Q9FII7	7.60e-15	82.0	1057	0.045	0.047	SMC6B_ARATH Structural maintenance of chromosomes protein 6B OS=Arabidopsis thaliana OX=3702 GN=SMC6B PE=2 SV=1
15	Q9FLR5	7.05e-14	79.0	1058	0.048	0.050	SMC6A_ARATH Structural maintenance of chromosomes protein 6A OS=Arabidopsis thaliana OX=3702 GN=SMC6A PE=2 SV=1
16	A0A2S1ZR87	3.16e-12	73.6	1091	0.080	0.081	A0A2S1ZR87_HUMAN Structural maintenance of chromosomes 6 OS=Homo sapiens OX=9606 GN=SMC6 PE=2 SV=1
17	Q96SB8	3.16e-12	73.6	1091	0.080	0.081	SMC6_HUMAN Structural maintenance of chromosomes protein 6 OS=Homo sapiens OX=9606 GN=SMC6 PE=1 SV=2
18	Q924W5	5.83e-12	72.8	1097	0.074	0.075	SMC6_MOUSE Structural maintenance of chromosomes protein 6 OS=Mus musculus OX=10090 GN=Smc6 PE=1 SV=1
19	Q12749	2.13e-10	67.8	1114	0.071	0.070	SMC6_YEAST Structural maintenance of chromosomes protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC6 PE=1 SV=1
20	Q9VCB8	9.85e-09	62.0	1122	0.071	0.070	Q9VCB8_DROME Java no jive OS=Drosophila melanogaster OX=7227 GN=SMC6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13175 AAA_15	1.3e-05	36.6	AAA ATPase domain
2	PF13304 AAA_21	0.0095	27.3	AAA domain, putative AbiEii toxin, Type IV TA system
3	PF13476 AAA_23	0.0092	28.0	AAA domain
4	PF13481 AAA_25	72	14.4	AAA domain
5	PF13555 AAA_29	63	14.7	P-loop containing region of AAA domain
6	PF05960 DUF885	3.9e+02	12.0	Bacterial protein of unknown function (DUF885)
7	PF13184 KH_5	3.5e+02	12.8	NusA-like KH domain
8	PF08659 KR	4.3e+02	12.2	KR domain
9	PF15035 Rootletin	13	17.3	Ciliary rootlet component, centrosome cohesion
10	PF02463 SMC_N	7.1e-15	66.6	RecF/RecN/SMC N terminal domain
11	PF02346 Vac_Fusion	5.3e+02	11.7	Chordopoxvirus multifunctional envelope protein A27
12	PF13997 YqjK	15	17.3	YqjK-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354957

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287437	0.999	E3 SUMO-protein ligase NSE2
2	9606.ENSP00000297338	0.999	Double-strand-break repair protein rad21 homolog
3	9606.ENSP00000330694	0.999	Non-structural maintenance of chromosomes element 3 homolog
4	9606.ENSP00000355077	0.999	Non-structural maintenance of chromosomes element 1 homolog
5	9606.ENSP00000358019	0.999	Non-structural maintenance of chromosomes element 4 homolog A
6	9606.ENSP00000404092	0.999	Structural maintenance of chromosomes protein 6
7	9606.ENSP00000435619	0.999	EP300-interacting inhibitor of differentiation 3
8	9606.ENSP00000354720	0.998	Structural maintenance of chromosomes protein 3
9	9606.ENSP00000323421	0.986	Structural maintenance of chromosomes protein 1A
10	9606.ENSP00000348056	0.982	SUMO-conjugating enzyme UBC9
11	9606.ENSP00000372689	0.982	Cohesin subunit SA-1
12	9606.ENSP00000218089	0.980	Cohesin subunit SA-2
13	9606.ENSP00000349961	0.977	Structural maintenance of chromosomes protein 4
14	9606.ENSP00000376077	0.968	Small ubiquitin-related modifier 1
15	9606.ENSP00000282516	0.963	Nipped-B-like protein
16	9606.ENSP00000318635	0.963	Small ubiquitin-related modifier 4
17	9606.ENSP00000286398	0.960	Structural maintenance of chromosomes protein 2
18	9606.ENSP00000257934	0.940	Separin
19	9606.ENSP00000240423	0.923	Condensin complex subunit 2
20	9606.ENSP00000234420	0.916	DNA mismatch repair protein Msh6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.616	heterocyclic compound binding
GO:0097159	0.616	organic cyclic compound binding
GO:0019899	0.616	enzyme binding
GO:0003824	0.409	catalytic activity
GO:0003676	0.402	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0008152	0.993	metabolic process
GO:0044238	0.983	primary metabolic process
GO:0006807	0.979	nitrogen compound metabolic process
GO:0043170	0.975	macromolecule metabolic process
GO:0016043	0.975	cellular component organization
GO:0051276	0.945	chromosome organization
GO:0050789	0.865	regulation of biological process
GO:0050896	0.772	response to stimulus
GO:0050794	0.764	regulation of cellular process
GO:0044237	0.762	cellular metabolic process
GO:0051716	0.734	cellular response to stimulus
GO:0006725	0.648	cellular aromatic compound metabolic process
GO:0044260	0.642	cellular macromolecule metabolic process
GO:1901360	0.641	organic cyclic compound metabolic process
GO:0046483	0.640	heterocycle metabolic process
GO:0034641	0.640	cellular nitrogen compound metabolic process
GO:0006259	0.606	DNA metabolic process
GO:0006950	0.580	response to stress
GO:0033554	0.526	cellular response to stress
GO:0006974	0.489	cellular response to DNA damage stimulus
GO:0048518	0.434	positive regulation of biological process
GO:0048522	0.339	positive regulation of cellular process
GO:0007049	0.325	cell cycle
GO:0006281	0.308	DNA repair
GO:0022402	0.307	cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000781	1.000	chromosome, telomeric region
GO:0030915	0.999	Smc5-Smc6 complex
GO:0016605	0.999	PML body
GO:0005737	0.919	cytoplasm
GO:0090734	0.709	site of DNA damage
GO:0000775	0.583	chromosome, centromeric region
GO:0030054	0.516	cell junction
GO:0035861	0.511	site of double-strand break
GO:0005829	0.430	cytosol
GO:0016607	0.423	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]