StarFunc result for job id Q8IY21

User Input

>input (1712 residues)
MERNVLTTFSQEMSQLILNEMPKAEYSSLFNDFVESEFFLIDGDSLLITCICEISFKPGQ
NLHFFYLVERYLVDLISKGGQFTIVFFKDAEYAYFNFPELLSLRTALILHLQKNTTIDVR
TTFSRCLSKEWGSFLEESYPYFLIVADEGLNDLQTQLFNFLIIHSWARKVNVVLSSGQES
DVLCLYAYLLPSMYRHQIFSWKNKQNIKDAYTTLLNQLERFKLSALAPLFGSLKWNNITE
EAHKTVSLLTQVWPEGSDIRRVFCVTSCSLSLRMYHRFLGNREPSSGQETEIQQVNSNCL
TLQEMEDLCKLHCLTVVFLLHLPLSQRACARVITSHWAEDMKPLLQMKKWCEYFILRNIH
TFEFWNLNLIHLSDLNDELLLKNIAFYYENENVKGLHLNLGDTIMKDYEYLWNTVSKLVR
DFEVGQPFPLRTTKVCFLEKKPSPIKDSSNEMVPNLGFIPTSSFVVDKFAGDILKDLPFL
KSDDPIVTSLVKQKEFDELVHWHSHKPLSDDYDRSRCQFDEKSRDPRVLRSVQKYHVFQR
FYGNSLETVSSKIIVTQTIKSKKDFSGPKSKKAHETKAEIIARENKKRLFAREEQKEEQK
WNALSFSIEEQLKENLHSGIKSLEDFLKSCKSSCVKLQVEMVGLTACLKAWKEHCRSEEG
KTTKDLSIAVQVMKRIHSLMEKYSELLQEDDRQLIARCLKYLGFDELASSLHPAQDAEND
VKVKKRNKYSVGIGPARFQLQYMGHYLIRDERKDPDPRVQDFIPDTWQRELLDVVDKNES
AVIVAPTSSGKTYASYYCMEKVLKESDDGVVVYVAPTKALVNQVAATVQNRFTKNLPSGE
VLCGVFTREYRHDALNCQVLITVPACFEILLLAPHRQNWVKKIRYVIFDEVHCLGGEIGA
EIWEHLLVMIRCPFLALSATISNPEHLTEWLQSVKWYWKQEDKIIENNTASKRHVGRQAG
FPKDYLQVKQSYKVRLVLYGERYNDLEKHVCSIKHGDIHFDHFHPCAALTTDHIERYGFP
PDLTLSPRESIQLYDAMFQIWKSWPRAQELCPENFIHFNNKLVIKKMDARKYEESLKAEL
TSWIKNGNVEQARMVLQNLSPEADLSPENMITMFPLLVEKLRKMEKLPALFFLFKLGAVE
NAAESVSTFLKKKQETKRPPKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQS
LIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRVKFERKGEELKALAERG
IGYHHSAMSFKEKQLVEILFRKGYLRVVTATGTLALGVNMPCKSVVFAQNSVYLDALNYR
QMSGRAGRRGQDLMGDVYFFDIPFPKIGKLIKSNVPELRGHFPLSITLVLRLMLLASKGD
DPEDAKAKVLSVLKHSLLSFKQPRVMDMLKLYFLFSLQFLVKEGYLDQEGNPMGFAGLVS
HLHYHEPSNLVFVSFLVNGLFHDLCQPTRKGSKHFSQDVMEKLVLVLAHLFGRRYFPPKF
QDAHFEFYQSKVFLDDLPEDFSDALDEYNMKIMEDFTTFLRIVSKLADMNQEYQLPLSKI
KFTGKECEDSQLVSHLMSCKEGRVAISPFVCLSGNFDDDLLRLETPNHVTLGTIGVNRSQ
APVLLSQKFDNRGRKMSLNAYALDFYKHGSLIGLVQDNRMNEGDAYYLLKDFALTIKSIS
VSLRELCENEDDNVVLAFEQLSTTFWEKLNKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PZQ1	0.981	0.981	0.000	1711	0.751	0.751	E9PZQ1.pdb.gz	E9PZQ1_MOUSE DExD/H box helicase 60 OS=Mus musculus OX=10090 GN=Ddx60 PE=1 SV=1
2	AFDB:Q8IY21	1.000	1.000	0.000	1712	1.000	1.000	Q8IY21.pdb.gz	DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens OX=9606 GN=DDX60 PE=1 SV=3
3	AFDB:Q9P7T8	0.763	0.761	1.352E-84	1717	0.270	0.270	Q9P7T8.pdb.gz	YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC694.02 PE=3 SV=1
4	AFDB:Q582X2	0.385	0.309	1.522E-58	2170	0.230	0.181	Q582X2.pdb.gz	Q582X2_TRYB2 ATP-dependent DEAD/H RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.220 PE=4 SV=1
5	AFDB:Q38AL9	0.279	0.481	5.511E-20	950	0.097	0.175	Q38AL9.pdb.gz	Q38AL9_TRYB2 ATP-dependent DEAD/H RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3220 PE=4 SV=1
6	AFDB:Q9XIF2	0.292	0.488	3.407E-19	988	0.092	0.160	Q9XIF2.pdb.gz	MTR4_ARATH DExH-box ATP-dependent RNA helicase DExH9 OS=Arabidopsis thaliana OX=3702 GN=MTR4 PE=2 SV=1
7	PDB:6d6qM	0.276	0.616	4.111E-19	709	0.089	0.216	6d6qM.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
8	AFDB:P9WMR1	0.268	0.482	8.471E-19	906	0.091	0.172	P9WMR1.pdb.gz	HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=helY PE=1 SV=1
9	PDB:2xgjB	0.292	0.598	8.594E-19	777	0.087	0.192	2xgjB.pdb.gz	Structural Analysis Reveals the Characteristic Features of Mtr4, a Dexh Helicase Involved in Nuclear RNA Processing and Surveillance.
10	AFDB:O13799	0.282	0.450	1.099E-18	1030	0.098	0.163	O13799.pdb.gz	YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17H9.02 PE=1 SV=1
11	PDB:6ro1A	0.279	0.491	1.385E-18	919	0.094	0.175	6ro1A.pdb.gz	The MTR4 helicase recruits nuclear adaptors of the human RNA exosome using distinct arch-interacting motifs.
12	AFDB:Q873J5	0.289	0.433	1.489E-18	1106	0.091	0.141	Q873J5.pdb.gz	Q873J5_NEUCS FRQ-interacting RNA helicase OS=Neurospora crassa OX=5141 GN=B9B11.040 PE=1 SV=1
13	AFDB:P47047	0.259	0.399	2.732E-18	1073	0.096	0.153	P47047.pdb.gz	MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTR4 PE=1 SV=1
14	PDB:6iegA	0.266	0.491	4.277E-18	872	0.091	0.178	6iegA.pdb.gz	NRDE2 negatively regulates exosome functions by inhibiting MTR4 recruitment and exosome interaction.
15	PDB:7qdyA	0.255	0.363	1.862E-16	1169	0.093	0.137	7qdyA.pdb.gz	The human SKI complex regulates channeling of ribosome-bound RNA to the exosome via an intrinsic gatekeeping mechanism.
16	PDB:7z4yB	0.218	0.390	6.525E-15	930	0.077	0.142	7z4yB.pdb.gz
17	PDB:5mc6h	0.220	0.329	6.814E-15	1121	0.078	0.119	5mc6h.pdb.gz	The cryo-EM structure of a ribosome-Ski2-Ski3-Ski8 helicase complex.
18	PDB:4xgtA	0.257	0.436	9.641E-15	961	0.088	0.156	4xgtA.pdb.gz
19	PDB:5dcaA	0.218	0.194	1.554E-14	1948	0.090	0.079	5dcaA.pdb.gz
20	PDB:7d4iM4	0.210	0.356	1.359E-13	978	0.077	0.135	7d4iM4.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3G9HN97	0.0	3554	1712	1.000	1.000	A0A3G9HN97_HUMAN ATP-dependent RNA helicase DDX60 OS=Homo sapiens OX=9606 GN=DDX60 PE=2 SV=1
2	D3Z3B3	0.0	788	573	0.225	0.674	D3Z3B3_MOUSE DExD/H box helicase 60 (Fragment) OS=Mus musculus OX=10090 GN=Ddx60 PE=1 SV=1
3	E9PZQ1	0.0	2645	1711	0.750	0.750	E9PZQ1_MOUSE DExD/H box helicase 60 OS=Mus musculus OX=10090 GN=Ddx60 PE=1 SV=1
4	G3X9F7	0.0	2638	1710	0.749	0.750	G3X9F7_MOUSE DExD/H box helicase 60 OS=Mus musculus OX=10090 GN=Ddx60 PE=1 SV=1
5	Q811K8	0.0	805	586	0.230	0.672	Q811K8_MOUSE Ddx60 protein (Fragment) OS=Mus musculus OX=10090 GN=Ddx60 PE=2 SV=1
6	Q8CB98	0.0	798	578	0.228	0.676	Q8CB98_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Ddx60 PE=2 SV=1
7	Q8IY21	0.0	3554	1712	1.000	1.000	DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens OX=9606 GN=DDX60 PE=1 SV=3
8	Q91VI2	0.0	637	391	0.181	0.793	Q91VI2_MOUSE Ddx60 protein OS=Mus musculus OX=10090 GN=Ddx60 PE=2 SV=1
9	Q9P7T8	1.69e-148	502	1717	0.220	0.219	YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC694.02 PE=3 SV=1
10	Q582X2	9.99e-61	233	2170	0.102	0.080	Q582X2_TRYB2 ATP-dependent DEAD/H RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.220 PE=4 SV=1
11	D3YZ76	4.38e-26	104	69	0.030	0.739	D3YZ76_MOUSE DExD/H box helicase 60 (Fragment) OS=Mus musculus OX=10090 GN=Ddx60 PE=4 SV=1
12	O13799	1.85e-18	94.7	1030	0.039	0.064	YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17H9.02 PE=1 SV=1
13	Q588V7	2.89e-18	94.4	2154	0.026	0.020	TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana OX=3702 GN=TEB PE=2 SV=1
14	P47047	9.92e-17	89.0	1073	0.034	0.054	MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTR4 PE=1 SV=1
15	Q6P7X6	6.65e-16	86.3	1034	0.030	0.049	Q6P7X6_DANRE Superkiller viralicidic activity 2-like 2 OS=Danio rerio OX=7955 GN=skiv2l2 PE=1 SV=1
16	O14232	9.72e-16	85.9	1117	0.033	0.050	MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mtr4 PE=1 SV=1
17	Q8CGS6	1.03e-15	86.3	2544	0.025	0.017	DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus OX=10090 GN=Polq PE=1 SV=2
18	P42285	2.42e-15	84.7	1042	0.030	0.050	MTREX_HUMAN Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3
19	Q38AL9	4.61e-15	83.6	950	0.032	0.057	Q38AL9_TRYB2 ATP-dependent DEAD/H RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3220 PE=4 SV=1
20	Q15477	5.01e-15	83.6	1246	0.033	0.045	SKI2_HUMAN Superkiller complex protein 2 OS=Homo sapiens OX=9606 GN=SKIC2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00270 DEAD	4.5e-14	64.1	DEAD/DEAH box helicase
2	PF00271 Helicase_C	0.0034	29.1	Helicase conserved C-terminal domain
3	PF04851 ResIII	1.8e-09	49.3	Type III restriction enzyme, res subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377344

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369213	0.992	Probable ATP-dependent RNA helicase DDX58
2	9606.ENSP00000263642	0.935	Interferon-induced helicase C domain-containing protein 1
3	9606.ENSP00000360869	0.926	Interferon-induced protein with tetratricopeptide repeats 1
4	9606.ENSP00000371471	0.920	Radical S-adenosyl methionine domain-containing protein 2
5	9606.ENSP00000360883	0.915	Interferon-induced protein with tetratricopeptide repeats 3
6	9606.ENSP00000264346	0.912	Probable E3 ubiquitin-protein ligase HERC6
7	9606.ENSP00000359783	0.912	Interferon-induced protein 44
8	9606.ENSP00000359787	0.904	Interferon-induced protein 44-like
9	9606.ENSP00000342278	0.895	2'-5'-oligoadenylate synthase 2
10	9606.ENSP00000228928	0.887	2'-5'-oligoadenylate synthase 3
11	9606.ENSP00000388001	0.874	2'-5'-oligoadenylate synthase 1
12	9606.ENSP00000264350	0.871	E3 ISG15--protein ligase HERC5
13	9606.ENSP00000257570	0.870	2'-5'-oligoadenylate synthase-like protein
14	9606.ENSP00000381601	0.868	Interferon-induced GTP-binding protein Mx1
15	9606.ENSP00000368699	0.867	Ubiquitin-like protein ISG15
16	9606.ENSP00000360860	0.864	Interferon-induced protein with tetratricopeptide repeats 5
17	9606.ENSP00000360891	0.857	Interferon-induced protein with tetratricopeptide repeats 2
18	9606.ENSP00000326247	0.855	Sterile alpha motif domain-containing protein 9-like
19	9606.ENSP00000259030	0.842	Receptor-transporting protein 4
20	9606.ENSP00000354394	0.838	Signal transducer and activator of transcription 1-alpha/beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003677	0.698	DNA binding
GO:0003725	0.596	double-stranded RNA binding
GO:0003727	0.594	single-stranded RNA binding
GO:0003690	0.589	double-stranded DNA binding
GO:0003824	0.484	catalytic activity
GO:0140640	0.438	catalytic activity, acting on a nucleic acid
GO:0140098	0.335	catalytic activity, acting on RNA

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0009615	0.974	response to virus
GO:0065007	0.869	biological regulation
GO:0050789	0.852	regulation of biological process
GO:0006950	0.746	response to stress
GO:0050794	0.691	regulation of cellular process
GO:0098542	0.684	defense response to other organism
GO:0051607	0.673	defense response to virus
GO:0048518	0.430	positive regulation of biological process
GO:0048583	0.381	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.968	intracellular organelle
GO:0043232	0.963	intracellular non-membrane-bounded organelle
GO:0005829	0.953	cytosol
GO:0043227	0.655	membrane-bounded organelle
GO:0043231	0.540	intracellular membrane-bounded organelle
GO:0070013	0.497	intracellular organelle lumen
GO:0031981	0.489	nuclear lumen
GO:0005654	0.479	nucleoplasm
GO:0005856	0.474	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]