StarFunc result for job id Q8IY26

User Input

>input (295 residues)
MPSPRRSMEGRPLGVSASSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATAVDPTCARLRA
SESPVHRRGSFPLAAAGPSQSPAPPLPEEDRMDLNPSFLGIALRSLLAIDLWLSKKLGVC
AGESSSWGSVRPLMKLLEISGHGIPWLLGTLYCLCRSDSWAGREVLMNLLFALLLDLLLV
ALIKGLVRRRRPAHNQMDMFVTLSVDKYSFPSGHATRAALMSRFILNHLVLAIPLRVLVV
LWAFVLGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWLSPHNAPVLFLLWSQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IY26	1.000	1.000	5.972E-40	295	1.000	1.000	Q8IY26.pdb.gz	PLPP6_HUMAN Polyisoprenoid diphosphate/phosphate phosphohydrolase PLPP6 OS=Homo sapiens OX=9606 GN=PLPP6 PE=1 SV=3
2	AFDB:Q91WB2	0.682	0.740	2.964E-20	271	0.410	0.446	Q91WB2.pdb.gz	PLPP7_MOUSE Inactive phospholipid phosphatase 7 OS=Mus musculus OX=10090 GN=Plpp7 PE=1 SV=1
3	AFDB:Q969M3	0.233	0.253	5.784E-2	257	0.149	0.171	Q969M3.pdb.gz	YIPF5_HUMAN Protein YIPF5 OS=Homo sapiens OX=9606 GN=YIPF5 PE=1 SV=1
4	PDB:5jwyA	0.294	0.330	6.460E-2	259	0.119	0.135	5jwyA.pdb.gz	Structural Insight into Substrate Selection and Catalysis of Lipid Phosphate Phosphatase PgpB in the Cell Membrane.
5	AFDB:A1L4X0	0.124	0.095	7.763E-2	431	0.125	0.086	A1L4X0.pdb.gz	CLT2_ARATH Protein CLT2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLT2 PE=2 SV=1
6	AFDB:Q94A99	0.109	0.099	1.331E-1	365	0.200	0.162	Q94A99.pdb.gz	CGF1_ARATH Chloroplast protein FOR GROWTH AND FERTILITY 1 OS=Arabidopsis thaliana OX=3702 GN=CGF1 PE=2 SV=1
7	AFDB:Q9ESF4	0.110	0.103	1.398E-1	345	0.142	0.122	Q9ESF4.pdb.gz	LFG1_MOUSE Protein lifeguard 1 OS=Mus musculus OX=10090 GN=Grina PE=2 SV=1
8	AFDB:Q9SHU7	0.168	0.168	1.398E-1	296	0.119	0.118	Q9SHU7.pdb.gz	TIC21_ARATH Protein TIC 21, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC21 PE=1 SV=1
9	AFDB:Q3UEZ8	0.138	0.105	1.468E-1	437	0.153	0.103	Q3UEZ8.pdb.gz	NTCP4_MOUSE Sodium/bile acid cotransporter 4 OS=Mus musculus OX=10090 GN=Slc10a4 PE=2 SV=1
10	AFDB:Q96EP9	0.137	0.101	1.542E-1	437	0.163	0.110	Q96EP9.pdb.gz	NTCP4_HUMAN Sodium/bile acid cotransporter 4 OS=Homo sapiens OX=9606 GN=SLC10A4 PE=1 SV=2
11	AFDB:Q54WI0	0.123	0.040	2.069E-1	1333	0.153	0.034	Q54WI0.pdb.gz	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
12	PDB:6bwjB	0.138	0.082	8.270E-1	617	0.098	0.047	6bwjB.pdb.gz	Conformational plasticity in the selectivity filter of the TRPV2 ion channel.
13	PDB:7w2zR	0.178	0.175	1.006	301	0.081	0.080	7w2zR.pdb.gz	Molecular mechanism of agonism and inverse agonism in ghrelin receptor.
14	PDB:7oqzA	0.205	0.243	1.110	237	0.112	0.139	7oqzA.pdb.gz
15	PDB:7x9yR	0.166	0.167	1.166	293	0.081	0.082	7x9yR.pdb.gz
16	PDB:6m9tA	0.178	0.129	1.564	444	0.078	0.052	6m9tA.pdb.gz	Crystal structure of misoprostol bound to the labor inducer prostaglandin E2receptor.
17	PDB:7kycA	0.268	0.079	1.564	1178	0.051	0.013	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
18	PDB:6nwdA	0.133	0.155	1.643	246	0.112	0.134	6nwdA.pdb.gz	X-ray Crystallographic Structure and Oligomerization of Gloeobacter Rhodopsin.
19	PDB:7e9gR	0.146	0.076	1.643	769	0.112	0.043	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
20	PDB:6cm4A	0.182	0.141	1.812	423	0.078	0.054	6cm4A.pdb.gz	Structure of the D2 dopamine receptor bound to the atypical antipsychotic drug risperidone.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IY26	0.0	586	295	1.000	1.000	PLPP6_HUMAN Polyisoprenoid diphosphate/phosphate phosphohydrolase PLPP6 OS=Homo sapiens OX=9606 GN=PLPP6 PE=1 SV=3
2	Q91WB2	2.17e-77	238	271	0.420	0.458	PLPP7_MOUSE Inactive phospholipid phosphatase 7 OS=Mus musculus OX=10090 GN=Plpp7 PE=1 SV=1
3	Q9JI99	0.001	42.4	430	0.112	0.077	SGPP1_MOUSE Sphingosine-1-phosphate phosphatase 1 OS=Mus musculus OX=10090 GN=Sgpp1 PE=1 SV=1
4	Q9BX95	0.018	38.9	441	0.122	0.082	SGPP1_HUMAN Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=SGPP1 PE=1 SV=2
5	B7Z0R9	0.12	36.6	1006	0.088	0.026	B7Z0R9_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG15518 PE=4 SV=2
6	Q9VAE4	0.12	36.6	1007	0.088	0.026	Q9VAE4_DROME RE09305p OS=Drosophila melanogaster OX=7227 GN=CG15516 PE=2 SV=2
7	P24433	0.15	36.2	528	0.146	0.081	SCAF_HHV6U Capsid scaffolding protein OS=Human herpesvirus 6A (strain Uganda-1102) OX=10370 GN=U53 PE=3 SV=2
8	Q7TMB7	0.25	35.4	766	0.075	0.029	PLPR4_RAT Phospholipid phosphatase-related protein type 4 OS=Rattus norvegicus OX=10116 GN=Plppr4 PE=1 SV=1
9	Q7Z2D5	0.53	34.3	763	0.071	0.028	PLPR4_HUMAN Phospholipid phosphatase-related protein type 4 OS=Homo sapiens OX=9606 GN=PLPPR4 PE=1 SV=1
10	Q7TME0	0.67	33.9	766	0.071	0.027	PLPR4_MOUSE Phospholipid phosphatase-related protein type 4 OS=Mus musculus OX=10090 GN=Plppr4 PE=1 SV=2
11	B2RLI7	1.2	33.1	445	0.149	0.099	LPXE_PORG3 Lipid A 1-phosphatase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561) OX=431947 GN=lpxE PE=3 SV=1
12	Q9XI60	1.2	32.7	290	0.136	0.138	LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana OX=3702 GN=LPP2 PE=2 SV=1
13	B2RI48	1.4	32.3	236	0.122	0.153	LPXF_PORG3 Lipid A 4'-phosphatase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561) OX=431947 GN=lpxF PE=3 SV=1
14	Q0PBM2	1.6	32.7	769	0.081	0.031	Q0PBM2_CAMJE histidine kinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=cheA PE=1 SV=1
15	Q9C6B8	2.8	32.0	622	0.061	0.029	PINI_ARATH Auxin efflux carrier component 1 OS=Arabidopsis thaliana OX=3702 GN=PIN1 PE=1 SV=1
16	Q7TPB0	3.0	32.0	716	0.081	0.034	PLPR3_MOUSE Phospholipid phosphatase-related protein type 3 OS=Mus musculus OX=10090 GN=Plppr3 PE=1 SV=1
17	Q8TBJ4	3.0	31.6	325	0.088	0.080	PLPR1_HUMAN Phospholipid phosphatase-related protein type 1 OS=Homo sapiens OX=9606 GN=PLPPR1 PE=1 SV=1
18	Q14155	3.1	32.0	803	0.085	0.031	ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7 PE=1 SV=2
19	Q9UUA6	3.3	31.6	279	0.163	0.172	DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dpp1 PE=3 SV=1
20	Q9W5A4	3.7	32.0	979	0.058	0.017	Q9W5A4_DROME EG:114D9.2 protein OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01569 PAP2	4.7e-13	60.6	PAP2 superfamily
2	PF14378 PAP2_3	1.1	20.6	PAP2 superfamily
3	PF14360 PAP2_C	2e+02	13.9	PAP2 superfamily C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371307

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264775	0.910	Phospholipid phosphatase 1
2	9606.ENSP00000356702	0.788	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
3	9606.ENSP00000343629	0.772	Protein PRRC2C
4	9606.ENSP00000354920	0.748	Methyltransferase-like protein 13
5	9606.ENSP00000037502	0.698	Myocilin
6	9606.ENSP00000236192	0.685	Vesicle-associated membrane protein 4
7	9606.ENSP00000252998	0.635	RBBP8 N-terminal-like protein
8	9606.ENSP00000381104	0.596	Transmembrane 9 superfamily member 4
9	9606.ENSP00000394869	0.549	Translation initiation factor eIF-2B subunit delta
10	9606.ENSP00000484228	0.548	All-trans retinoic acid-induced differentiation factor
11	9606.ENSP00000289119	0.519	Phospholipase ABHD3
12	9606.ENSP00000329697	0.511	Phospholipid phosphatase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016462	1.000	pyrophosphatase activity
GO:0008195	1.000	phosphatidate phosphatase activity
GO:0042392	0.998	sphingosine-1-phosphate phosphatase activity
GO:0052642	0.989	lysophosphatidic acid phosphatase activity
GO:0106405	0.982	isoprenoid diphosphate phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0006629	0.983	lipid metabolic process
GO:0050789	0.975	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0006644	0.972	phospholipid metabolic process
GO:0006807	0.960	nitrogen compound metabolic process
GO:0009058	0.956	biosynthetic process
GO:1901564	0.949	organonitrogen compound metabolic process
GO:0048518	0.918	positive regulation of biological process
GO:0048522	0.900	positive regulation of cellular process
GO:0043170	0.836	macromolecule metabolic process
GO:0019538	0.804	protein metabolic process
GO:1901576	0.612	organic substance biosynthetic process
GO:0008610	0.556	lipid biosynthetic process
GO:0016311	0.542	dephosphorylation
GO:0006066	0.538	alcohol metabolic process
GO:0002682	0.532	regulation of immune system process
GO:0046839	0.526	phospholipid dephosphorylation
GO:0036211	0.493	protein modification process
GO:1901575	0.479	organic substance catabolic process
GO:0002684	0.479	positive regulation of immune system process
GO:0006720	0.446	isoprenoid metabolic process
GO:0044242	0.446	cellular lipid catabolic process
GO:0046434	0.445	organophosphate catabolic process
GO:0046165	0.445	alcohol biosynthetic process
GO:0008203	0.445	cholesterol metabolic process
GO:1902653	0.442	secondary alcohol biosynthetic process
GO:0051239	0.425	regulation of multicellular organismal process
GO:0006695	0.422	cholesterol biosynthetic process
GO:0006721	0.418	terpenoid metabolic process
GO:0050865	0.407	regulation of cell activation
GO:0002694	0.403	regulation of leukocyte activation
GO:0050867	0.400	positive regulation of cell activation
GO:0008300	0.399	isoprenoid catabolic process
GO:0009395	0.397	phospholipid catabolic process
GO:0002696	0.393	positive regulation of leukocyte activation
GO:0045338	0.370	farnesyl diphosphate metabolic process
GO:0016115	0.362	terpenoid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005635	0.998	nuclear envelope
GO:0005783	0.997	endoplasmic reticulum
GO:0031090	0.994	organelle membrane
GO:0031984	0.949	organelle subcompartment
GO:0005789	0.921	endoplasmic reticulum membrane
GO:0031965	0.720	nuclear membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	1.000	In phosphorus-containing anhydrides.
RHEA:27429	1.000	a 1,2-diacyl-sn-glycero-3-phosphate + H2O = a 1,2-diacyl-sn-glycerol + phosphate
EC:3.1.3.4	1.000	phosphatidate phosphatase.
RHEA:27518	0.998	H2O + sphing-4-enine 1-phosphate = phosphate + sphing-4-enine

[back to server]