StarFunc result for job id Q8IY31

User Input

>input (132 residues)
MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQ
LAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAE
QNEFIDQFIFQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZSV1	0.983	0.828	3.028E-14	157	0.992	0.834	D3ZSV1.pdb.gz	D3ZSV1_RAT Intraflagellar transport 20 OS=Rattus norvegicus OX=10116 GN=Ift20 PE=4 SV=1
2	AFDB:Q66I67	0.977	0.977	1.160E-12	132	0.864	0.864	Q66I67.pdb.gz	IFT20_DANRE Intraflagellar transport protein 20 homolog OS=Danio rerio OX=7955 GN=ift20 PE=2 SV=1
3	AFDB:Q8TA52	0.596	0.609	1.988E-4	129	0.348	0.357	Q8TA52.pdb.gz	IFT20_CAEEL Intraflagellar transport protein 20 homolog OS=Caenorhabditis elegans OX=6239 GN=ift-20 PE=1 SV=1
4	AFDB:Q584X2	0.758	0.768	3.858E-4	130	0.364	0.369	Q584X2.pdb.gz	Q584X2_TRYB2 Intraflagellar transport (IFT) protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.2N9.700 PE=4 SV=1
5	PDB:4d10H	0.127	0.101	2.990	173	0.068	0.052	4d10H.pdb.gz	Crystal Structure of the Human Cop9 Signalosome
6	AFDB:Q9XWF2	0.317	0.111	3.392	404	0.083	0.027	Q9XWF2.pdb.gz	Q9XWF2_CAEEL DNA/RNA-binding protein Kin17 WH-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dxbp-1 PE=1 SV=1
7	AFDB:Q380X8	0.165	0.056	4.139	474	0.076	0.021	Q380X8.pdb.gz	Q380X8_TRYB2 Variant surface glycoprotein (VSG, atypical), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.21.0004 PE=4 SV=1
8	AFDB:Q57X36	0.167	0.056	4.422	485	0.076	0.021	Q57X36.pdb.gz	Q57X36_TRYB2 Variant surface glycoprotein (VSG, atypical), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26C7.490 PE=4 SV=1
9	AFDB:Q38BZ4	0.319	0.087	4.726	525	0.061	0.015	Q38BZ4.pdb.gz	Q38BZ4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5170 PE=4 SV=1
10	PDB:7nvw2	0.117	0.049	5.081	390	0.053	0.018	7nvw2.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
11	AFDB:Q7Z4S6	0.401	0.037	5.396	1674	0.098	0.008	Q7Z4S6.pdb.gz	KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2
12	AFDB:Q9DBZ5	0.142	0.089	5.765	218	0.038	0.023	Q9DBZ5.pdb.gz	EIF3K_MOUSE Eukaryotic translation initiation factor 3 subunit K OS=Mus musculus OX=10090 GN=Eif3k PE=1 SV=1
13	PDB:5fgjA	0.180	0.058	6.624	428	0.068	0.021	5fgjA.pdb.gz	Domain Movements upon Activation of Phenylalanine Hydroxylase Characterized by Crystallography and Chromatography-Coupled Small-Angle X-ray Scattering.
14	PDB:5n9jS	0.118	0.092	7.078	171	0.045	0.035	5n9jS.pdb.gz
15	PDB:5wlnA	0.118	0.044	7.078	396	0.045	0.015	5wlnA.pdb.gz
16	PDB:6hivAX	0.089	0.070	7.078	168	0.015	0.012	6hivAX.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:2ji4A	0.075	0.033	7.563	302	0.030	0.013	2ji4A.pdb.gz
18	PDB:2p0eA	0.141	0.103	8.081	190	0.053	0.037	2p0eA.pdb.gz	Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
19	PDB:5l4kR	0.161	0.059	8.081	389	0.076	0.026	5l4kR.pdb.gz
20	PDB:6wq2A	0.101	0.087	8.081	154	0.045	0.039	6wq2A.pdb.gz	Structures of filamentous viruses infecting hyperthermophilic archaea explain DNA stabilization in extreme environments.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IY31	6.27e-90	258	132	1.000	1.000	IFT20_HUMAN Intraflagellar transport protein 20 homolog OS=Homo sapiens OX=9606 GN=IFT20 PE=1 SV=1
2	D3ZSV1	1.35e-89	258	157	0.992	0.834	D3ZSV1_RAT Intraflagellar transport 20 OS=Rattus norvegicus OX=10116 GN=Ift20 PE=4 SV=1
3	Q61025	6.14e-89	256	132	0.985	0.985	IFT20_MOUSE Intraflagellar transport protein 20 homolog OS=Mus musculus OX=10090 GN=Ift20 PE=1 SV=1
4	Q66I67	3.51e-77	226	132	0.864	0.864	IFT20_DANRE Intraflagellar transport protein 20 homolog OS=Danio rerio OX=7955 GN=ift20 PE=2 SV=1
5	Q584X2	4.38e-19	79.0	130	0.341	0.346	Q584X2_TRYB2 Intraflagellar transport (IFT) protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.2N9.700 PE=4 SV=1
6	Q8TA52	1.28e-17	75.1	129	0.341	0.349	IFT20_CAEEL Intraflagellar transport protein 20 homolog OS=Caenorhabditis elegans OX=6239 GN=ift-20 PE=1 SV=1
7	Q6P5D8	0.11	34.3	2007	0.189	0.012	SMHD1_MOUSE Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Mus musculus OX=10090 GN=Smchd1 PE=1 SV=2
8	Q38FK9	0.22	32.7	196	0.212	0.143	Q38FK9_TRYB2 Cytochrome c oxidase subunit V, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1820 PE=4 SV=1
9	O82794	0.28	32.7	220	0.152	0.091	AGL24_ARATH MADS-box protein AGL24 OS=Arabidopsis thaliana OX=3702 GN=AGL24 PE=1 SV=1
10	F7BJB9	0.30	32.7	942	0.220	0.031	MORC3_MOUSE MORC family CW-type zinc finger protein 3 OS=Mus musculus OX=10090 GN=Morc3 PE=1 SV=1
11	P9WG25	0.50	32.0	700	0.106	0.020	TKT_MYCTU Transketolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=tkt PE=1 SV=1
12	Q9VK07	0.54	32.0	696	0.159	0.030	UVRAG_DROME UV radiation resistance-associated gene protein OS=Drosophila melanogaster OX=7227 GN=Uvrag PE=1 SV=1
13	Q96GR2	0.63	32.0	724	0.114	0.021	ACBG1_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens OX=9606 GN=ACSBG1 PE=1 SV=2
14	O88737	1.0	31.2	3942	0.129	0.004	BSN_MOUSE Protein bassoon OS=Mus musculus OX=10090 GN=Bsn PE=1 SV=4
15	O88778	1.6	30.8	3938	0.121	0.004	BSN_RAT Protein bassoon OS=Rattus norvegicus OX=10116 GN=Bsn PE=1 SV=3
16	Q5BEJ2	1.9	30.4	1433	0.106	0.010	Q5BEJ2_EMENI TMEM1 family protein, putative (AFU_orthologue AFUA_1G12540) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01038 PE=4 SV=1
17	O59757	2.3	30.4	1364	0.129	0.012	SPC7_SCHPO Kinetochore protein spc7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spc7 PE=1 SV=1
18	G5ECE3	2.8	30.0	3102	0.144	0.006	LAM3_CAEEL Laminin subunit alpha lam-3 OS=Caenorhabditis elegans OX=6239 GN=lam-3 PE=1 SV=1
19	E2RQ08	3.0	29.6	607	0.129	0.028	RPN1_CANLF Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Canis lupus familiaris OX=9615 GN=RPN1 PE=1 SV=1
20	F4K5J1	3.3	29.6	1531	0.106	0.009	MYO17_ARATH Myosin-17 OS=Arabidopsis thaliana OX=3702 GN=XI-K PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11333 DUF3135	60	15.3	Protein of unknown function (DUF3135)
2	PF00570 HRDC	17	16.7	HRDC domain
3	PF14931 IFT20	2e-48	174.9	Intraflagellar transport complex B, subunit 20
4	PF03980 Nnf1	52	15.6	Nnf1
5	PF06156 YabA	3.4e+02	13.3	Initiation control protein YabA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000019808

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000003774	0.984	Intraflagellar transport 57
2	9555.ENSPANP00000015348	0.947	Intraflagellar transport 88
3	9555.ENSPANP00000013583	0.940	Intraflagellar transport 140
4	9555.ENSPANP00000014804	0.934	TNF receptor-associated factor 3 interacting protein 1
5	9555.ENSPANP00000013088	0.905	Thyroid hormone receptor interactor 11
6	9555.ENSPANP00000017708	0.897	Intraflagellar transport 52
7	9555.ENSPANP00000011563	0.888	Intraflagellar transport 80
8	9555.ENSPANP00000018202	0.878	Intraflagellar transport 172
9	9555.ENSPANP00000015528	0.873	Intraflagellar transport 22
10	9555.ENSPANP00000019172	0.870	Intraflagellar transport 74
11	9555.ENSPANP00000001489	0.866	Intraflagellar transport 27
12	9555.ENSPANP00000004787	0.864	Intraflagellar transport 81
13	9555.ENSPANP00000000214	0.863	Intraflagellar transport 46
14	9555.ENSPANP00000013782	0.862	Clusterin associated protein 1
15	9555.ENSPANP00000016858	0.862	Kinesin-like protein
16	9555.ENSPANP00000015238	0.861	Kinesin-like protein
17	9555.ENSPANP00000009058	0.856	Heat shock protein family B (small), member 11
18	9555.ENSPANP00000015188	0.850	As a component of the IFT complex A (IFT-A), a complex required for retrograde ciliary transport and entry into cilia of G protein-coupled receptors (GPCRs), it is involved in ciliogenesis and ciliary protein trafficking
19	9555.ENSPANP00000007799	0.845	Kinesin family member 3A
20	9555.ENSPANP00000005462	0.815	Dynein, cytoplasmic 2, light intermediate chain 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016043	0.996	cellular component organization
GO:0006996	0.990	organelle organization
GO:0044085	0.988	cellular component biogenesis
GO:0030030	0.986	cell projection organization
GO:0008104	0.986	protein localization
GO:0033365	0.981	protein localization to organelle
GO:0050794	0.980	regulation of cellular process
GO:0070925	0.979	organelle assembly
GO:0030031	0.979	cell projection assembly
GO:0044782	0.978	cilium organization
GO:0120031	0.968	plasma membrane bounded cell projection assembly
GO:0060271	0.963	cilium assembly
GO:1902115	0.948	regulation of organelle assembly
GO:0060491	0.946	regulation of cell projection assembly
GO:0120032	0.925	regulation of plasma membrane bounded cell projection assembly
GO:1902017	0.804	regulation of cilium assembly
GO:0051234	0.391	establishment of localization
GO:0006810	0.367	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005737	1.000	cytoplasm
GO:0036064	0.999	ciliary basal body
GO:0016020	0.993	membrane
GO:0012505	0.993	endomembrane system
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0005813	0.978	centrosome
GO:0097542	0.946	ciliary tip
GO:0030990	0.930	intraciliary transport particle
GO:0043005	0.893	neuron projection
GO:0031982	0.883	vesicle
GO:0097730	0.819	non-motile cilium
GO:0005829	0.772	cytosol
GO:0035869	0.695	ciliary transition zone
GO:0097546	0.581	ciliary base
GO:0005794	0.537	Golgi apparatus
GO:0031090	0.509	organelle membrane
GO:0030992	0.472	intraciliary transport particle B
GO:0097731	0.428	9+0 non-motile cilium
GO:0097733	0.394	photoreceptor cell cilium
GO:0071944	0.369	cell periphery
GO:0098588	0.354	bounding membrane of organelle
GO:0032391	0.354	photoreceptor connecting cilium
GO:0099568	0.347	cytoplasmic region
GO:0031410	0.347	cytoplasmic vesicle
GO:0032838	0.341	plasma membrane bounded cell projection cytoplasm
GO:0005886	0.334	plasma membrane
GO:0005930	0.333	axoneme
GO:0036477	0.321	somatodendritic compartment
GO:0097447	0.310	dendritic tree

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]