StarFunc result for job id Q8IY33

User Input

>input (904 residues)
MAAIRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLINFSALKKENIYE
NNKLAFRVAEEHLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMAGVKR
ASEDSEEEPSGKKAPVQAAKLPSPAPARKPPLSPAQTNPVVQRRNEGAGGPPPKTDQALA
GSLVSSTCGVCGKHVHLVQRHLADGRLYHRSCFRCKQCSCTLHSGAYKATGEPGTFVCTS
HLPAAASASPKLTGLVPRQPGAMGVDSRTSCSPQKAQEANKARPSAWEPAAGNSPARASV
PAAPNPAATSATSVHVRSPARPSESRLAPTPTEGKVRPRVTNSSPMGWSSAAPCTAAAAS
HPAVPPSAPDPRPATPQGGGAPRVAAPQTTLSSSSTSAATVDPPAWTPSASRTQQARNKF
FQTSAVPPGTSLSGRGPTPSLVLSKDSSKEQARNFLKQALSALEEAGAPAPGRPSPATAA
VPSSQPKTEAPQASPLAKPLQSSSPRVLGLPSRMEPPAPLSTSSTSQASALPPAGRRNLA
ESSGVGRVGAGSRPKPEAPMAKGKSTTLTQDMSTSLQEGQEDGPAGWRANLKPVDRRSPA
ERTLKPKEPRALAEPRAGEAPRKVSGSFAGSVHITLTPVRPDRTPRPASPGPSLPARSPS
PPRRRRLAVPASLDVCDNWLRPEPPGQEARVQSWKEEEKKPHLQGKPGRPLSPANVPALP
GETVTSPVRLHPDYLSPEEIQRQLQDIERRLDALELRGVELEKRLRAAEGDDAEDSLMVD
WFWLIHEKQLLLRQESELMYKSKAQRLEEQQLDIEGELRRLMAKPEALKSLQERRREQEL
LEQYVSTVNDRSDIVDSLDEDRLREQEEDQMLRDMIEKLGLQRKKSKFRLSKIWSPKSKS
SPSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IY33	1.000	1.000	3.212E-100	904	1.000	1.000	Q8IY33.pdb.gz	MILK2_HUMAN MICAL-like protein 2 OS=Homo sapiens OX=9606 GN=MICALL2 PE=1 SV=1
2	AFDB:Q3TN34	0.460	0.415	3.405E-59	1009	0.604	0.541	Q3TN34.pdb.gz	MILK2_MOUSE MICAL-like protein 2 OS=Mus musculus OX=10090 GN=Micall2 PE=1 SV=1
3	AFDB:D3ZEN0	0.477	0.429	6.972E-58	1014	0.611	0.544	D3ZEN0.pdb.gz	MILK2_RAT MICAL-like protein 2 OS=Rattus norvegicus OX=10116 GN=Micall2 PE=1 SV=2
4	AFDB:F1QAZ3	0.383	0.436	4.978E-36	783	0.356	0.411	F1QAZ3.pdb.gz	F1QAZ3_DANRE Mical-like 2b OS=Danio rerio OX=7955 GN=MICAL-2 PE=1 SV=2
5	AFDB:E1BBG2	0.373	0.394	9.735E-32	853	0.346	0.367	E1BBG2.pdb.gz	MILK1_BOVIN MICAL-like protein 1 OS=Bos taurus OX=9913 GN=MICALL1 PE=1 SV=2
6	AFDB:Q8BGT6	0.372	0.386	2.218E-31	870	0.326	0.339	Q8BGT6.pdb.gz	MILK1_MOUSE MICAL-like protein 1 OS=Mus musculus OX=10090 GN=Micall1 PE=1 SV=3
7	AFDB:Q8N3F8	0.345	0.361	4.827E-31	863	0.322	0.337	Q8N3F8.pdb.gz	MILK1_HUMAN MICAL-like protein 1 OS=Homo sapiens OX=9606 GN=MICALL1 PE=1 SV=2
8	AFDB:Q7RTP6	0.210	0.102	9.291E-17	2002	0.317	0.143	Q7RTP6.pdb.gz	MICA3_HUMAN [F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2
9	AFDB:Q8C5W0	0.113	0.098	1.872E-5	1052	0.160	0.138	Q8C5W0.pdb.gz	CLMN_MOUSE Calmin OS=Mus musculus OX=10090 GN=Clmn PE=1 SV=2
10	PDB:4d1eA	0.111	0.117	6.206E-5	859	0.055	0.058	4d1eA.pdb.gz
11	PDB:1b8tA	0.061	0.230	3.809E-3	192	0.039	0.182	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
12	AFDB:F4HWC3	0.052	0.040	5.200E-3	1364	0.138	0.092	F4HWC3.pdb.gz	F4HWC3_ARATH Calponin-like domain protein OS=Arabidopsis thaliana OX=3702 GN=At1g20970 PE=1 SV=1
13	PDB:1imlA	0.061	0.567	6.019E-3	76	0.024	0.289	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:1sjjA	0.106	0.111	6.596E-3	863	0.052	0.054	1sjjA.pdb.gz
15	PDB:4kfzB	0.056	0.293	3.077E-1	148	0.015	0.095	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
16	PDB:4o9yA	0.074	0.028	1.750	2490	0.031	0.011	4o9yA.pdb.gz
17	PDB:7n8oQ	0.050	0.215	1.750	119	0.024	0.185	7n8oQ.pdb.gz	High-resolution cryo-electron microscopy structure of photosystem II from the mesophilic cyanobacterium, Synechocystis sp. PCC 6803.
18	PDB:7rroA0	0.102	0.336	2.007	221	0.030	0.122	7rroA0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:6n63A	0.066	0.365	2.641	141	0.022	0.142	6n63A.pdb.gz	Large protein organelles form a new iron sequestration system with high storage capacity.
20	PDB:5ew5A	0.112	0.197	3.476	490	0.033	0.061	5ew5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IY33	0.0	1814	904	1.000	1.000	MILK2_HUMAN MICAL-like protein 2 OS=Homo sapiens OX=9606 GN=MICALL2 PE=1 SV=1
2	D3ZEN0	1.26e-177	542	1014	0.314	0.280	MILK2_RAT MICAL-like protein 2 OS=Rattus norvegicus OX=10116 GN=Micall2 PE=1 SV=2
3	Q3TN34	3.49e-173	531	1009	0.308	0.276	MILK2_MOUSE MICAL-like protein 2 OS=Mus musculus OX=10090 GN=Micall2 PE=1 SV=1
4	F1QAZ3	2.04e-107	351	783	0.181	0.209	F1QAZ3_DANRE Mical-like 2b OS=Danio rerio OX=7955 GN=MICAL-2 PE=1 SV=2
5	Q8N3F8	1.05e-69	250	863	0.142	0.148	MILK1_HUMAN MICAL-like protein 1 OS=Homo sapiens OX=9606 GN=MICALL1 PE=1 SV=2
6	E1BBG2	1.45e-69	249	853	0.139	0.148	MILK1_BOVIN MICAL-like protein 1 OS=Bos taurus OX=9913 GN=MICALL1 PE=1 SV=2
7	D3ZQL6	6.76e-69	248	855	0.145	0.153	MILK1_RAT MICAL-like protein 1 OS=Rattus norvegicus OX=10116 GN=Micall1 PE=1 SV=1
8	Q7RTP6	1.75e-40	164	2002	0.102	0.046	MICA3_HUMAN [F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2
9	Q8BGT6	1.28e-31	135	870	0.082	0.085	MILK1_MOUSE MICAL-like protein 1 OS=Mus musculus OX=10090 GN=Micall1 PE=1 SV=3
10	L7UZ85	3.76e-30	130	885	0.066	0.068	ACTN_DERFA Alpha-actinin OS=Dermatophagoides farinae OX=6954 PE=1 SV=1
11	P05095	1.35e-29	129	861	0.060	0.063	ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum OX=44689 GN=abpA PE=1 SV=2
12	Q8TDZ2	1.23e-28	126	1067	0.088	0.075	MICA1_HUMAN [F-actin]-monooxygenase MICAL1 OS=Homo sapiens OX=9606 GN=MICAL1 PE=1 SV=2
13	O94851	1.49e-28	126	1957	0.071	0.033	MICA2_HUMAN [F-actin]-monooxygenase MICAL2 OS=Homo sapiens OX=9606 GN=MICAL2 PE=1 SV=2
14	Q9H254	1.78e-28	126	2564	0.063	0.022	SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens OX=9606 GN=SPTBN4 PE=1 SV=2
15	Q01082	3.39e-28	125	2364	0.061	0.023	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
16	G3V6S0	3.57e-28	125	2361	0.061	0.023	G3V6S0_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=1 SV=4
17	Q62261	3.89e-28	125	2363	0.061	0.023	SPTB2_MOUSE Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus OX=10090 GN=Sptbn1 PE=1 SV=2
18	Q6XD99	4.06e-28	125	2358	0.061	0.023	Q6XD99_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=2 SV=1
19	A0A0G2JZY6	5.01e-28	124	2152	0.061	0.026	A0A0G2JZY6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=1 SV=2
20	Q8BML1	5.23e-28	124	1951	0.103	0.048	MICA2_MOUSE [F-actin]-monooxygenase MICAL2 OS=Mus musculus OX=10090 GN=Mical2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12130 bMERB_dom	8.8e-37	137.6	Bivalent Mical/EHBP Rab binding domain
2	PF11971 CAMSAP_CH	0.00035	31.6	CAMSAP CH domain
3	PF00307 CH	1.3e-20	85.0	Calponin homology (CH) domain
4	PF00412 LIM	0.014	27.0	LIM domain
5	PF18160 SLATT_5	1e+03	10.4	SMODS and SLOG-associating 2TM effector domain family 5

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297508

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357564	0.996	Ras-related protein Rab-13
2	9606.ENSP00000300935	0.991	Ras-related protein Rab-8A
3	9606.ENSP00000252699	0.959	Alpha-actinin-4
4	9606.ENSP00000377941	0.897	Alpha-actinin-1
5	9606.ENSP00000312734	0.885	Ras-related protein Rab-8B
6	9606.ENSP00000256194	0.678	[F-actin]-monooxygenase MICAL2
7	9606.ENSP00000416015	0.663	[F-actin]-monooxygenase MICAL3
8	9606.ENSP00000256186	0.637	MICAL C-terminal-like protein
9	9606.ENSP00000352834	0.631	Unconventional myosin-Ic
10	9606.ENSP00000312671	0.624	EH domain-binding protein 1-like protein 1
11	9606.ENSP00000253754	0.614	PDZ and LIM domain protein 4
12	9606.ENSP00000348099	0.614	PDZ and LIM domain protein 7
13	9606.ENSP00000215957	0.613	MICAL-like protein 1
14	9606.ENSP00000263991	0.610	EH domain-binding protein 1
15	9606.ENSP00000367059	0.602	Espin
16	9606.ENSP00000284770	0.599	PDZ and LIM domain protein 3
17	9606.ENSP00000312634	0.599	PDZ and LIM domain protein 2
18	9606.ENSP00000360305	0.599	PDZ and LIM domain protein 1
19	9606.ENSP00000401437	0.599	LIM domain-binding protein 3
20	9606.ENSP00000480359	0.599	PDZ and LIM domain protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031005	1.000	filamin binding
GO:0003779	0.935	actin binding
GO:0019899	0.677	enzyme binding
GO:0051020	0.560	GTPase binding
GO:0031267	0.522	small GTPase binding
GO:0044877	0.323	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.975	regulation of cellular process
GO:0033157	0.915	regulation of intracellular protein transport
GO:1903533	0.908	regulation of protein targeting
GO:0048522	0.881	positive regulation of cellular process
GO:0051050	0.875	positive regulation of transport
GO:0009987	0.873	cellular process
GO:1903747	0.864	regulation of establishment of protein localization to mitochondrion
GO:0051222	0.813	positive regulation of protein transport
GO:0032388	0.809	positive regulation of intracellular transport
GO:0090316	0.750	positive regulation of intracellular protein transport
GO:0071840	0.679	cellular component organization or biogenesis
GO:0016043	0.662	cellular component organization
GO:0051179	0.539	localization
GO:0006996	0.418	organelle organization
GO:0051641	0.365	cellular localization
GO:0051234	0.318	establishment of localization
GO:0022607	0.312	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0043227	0.998	membrane-bounded organelle
GO:0012505	0.995	endomembrane system
GO:0043232	0.978	intracellular non-membrane-bounded organelle
GO:0005737	0.974	cytoplasm
GO:0043231	0.963	intracellular membrane-bounded organelle
GO:0016020	0.959	membrane
GO:0005829	0.950	cytosol
GO:0005634	0.940	nucleus
GO:0005856	0.876	cytoskeleton
GO:0031090	0.871	organelle membrane
GO:0015629	0.864	actin cytoskeleton
GO:0042995	0.849	cell projection
GO:0031982	0.835	vesicle
GO:0120025	0.824	plasma membrane bounded cell projection
GO:0031410	0.818	cytoplasmic vesicle
GO:0098588	0.785	bounding membrane of organelle
GO:0030054	0.782	cell junction
GO:0071944	0.686	cell periphery
GO:0005768	0.677	endosome
GO:0030659	0.672	cytoplasmic vesicle membrane
GO:0055037	0.615	recycling endosome
GO:0005886	0.514	plasma membrane
GO:0070013	0.459	intracellular organelle lumen
GO:0070161	0.454	anchoring junction
GO:0005576	0.449	extracellular region
GO:0031981	0.405	nuclear lumen
GO:0005654	0.371	nucleoplasm
GO:0010008	0.338	endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]