StarFunc result for job id Q8IY37

User Input

>input (1157 residues)
MGKLRRRYNIKGRQQAGPGPSKGPPEPPPVQLELEDKDTLKGVDASNALVLPGKKKKKTK
APPLSKKEKKPLTKKEKKVLQKILEQKEKKSQRAEMLQKLSEVQASEAEMRLFYTTSKLG
TGNRMYHTKEKADEVVAPGQEKISSLSGAHRKRRRWPSAEEEEEEEEESESELEEESELD
EDPAAEPAEAGVGTTVAPLPPAPAPSSQPVPAGMTVPPPPAAAPPLPRALAKPAVFIPVN
RSPEMQEERLKLPILSEEQVIMEAVAEHPIVIVCGETGSGKTTQVPQFLYEAGFSSEDSI
IGVTEPRRVAAVAMSQRVAKEMNLSQRVVSYQIRYEGNVTEETRIKFMTDGVLLKEIQKD
FLLLRYKVVIIDEAHERSVYTDILIGLLSRIVTLRAKRNLPLKLLIMSATLRVEDFTQNP
RLFAKPPPVIKVESRQFPVTVHFNKRTPLEDYSGECFRKVCKIHRMLPAGGILVFLTGQA
EVHALCRRLRKAFPPSRARPQEKDDDQKDSVEEMRKFKKSRARAKKARAEVLPQINLDHY
SVLPAGEGDEDREAEVDEEEGALDSDLDLDLGDGGQDGGEQPDASLPLHVLPLYSLLAPE
KQAQVFKPPPEGTRLCVVATNVAETSLTIPGIKYVVDCGKVKKRYYDRVTGVSSFRVTWV
SQASADQRAGRAGRTEPGHCYRLYSSAVFGDFEQFPPPEITRRPVEDLILQMKALNVEKV
INFPFPTPPSVEALLAAEELLIALGALQPPQKAERVKQLQENRLSCPITALGRTMATFPV
APRYAKMLALSRQHGCLPYAITIVASMTVRELFEELDRPAASDEELTRLKSKRARVAQMK
RTWAGQGASLKLGDLMVLLGAVGACEYASCTPQFCEANGLRYKAMMEIRRLRGQLTTAVN
AVCPEAELFVDPKMQPPTESQVTYLRQIVTAGLGDHLARRVQSEEMLEDKWRNAYKTPLL
DDPVFIHPSSVLFKELPEFVVYQEIVETTKMYMKGVSSVEVQWIPALLPSYCQFDKPLEE
PAPTYCPERGRVLCHRASVFYRVGWPLPAIEVDFPEGIDRYKHFARFLLEGQVFRKLASY
RSCLLSSPGTMLKTWARLQPRTESLLRALVAEKADCHEALLAAWKKNPKYLLAEYCEWLP
QAMHPDIEKAWPPTTVH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7mqaNS	0.426	0.520	0.000	914	0.787	0.997	7mqaNS.pdb.gz	Nucleolar maturation of the human small subunit processome.
2	AFDB:A0A0B6VLS4	0.746	0.749	0.000	1152	0.662	0.665	A0A0B6VLS4.pdb.gz
3	AFDB:Q8IY37	1.000	1.000	0.000	1157	1.000	1.000	Q8IY37.pdb.gz	DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens OX=9606 GN=DHX37 PE=1 SV=1
4	PDB:6h57A	0.479	0.661	2.492E-66	795	0.297	0.433	6h57A.pdb.gz	The DEAH-box RNA helicase Dhr1 contains a remarkable carboxyl terminal domain essential for small ribosomal subunit biogenesis.
5	PDB:6zqgJD	0.567	0.783	6.353E-59	829	0.297	0.415	6zqgJD.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
6	AFDB:X1WET4	0.512	0.856	7.119E-59	680	0.215	0.366	X1WET4.pdb.gz	X1WET4_DANRE ATP-dependent RNA helicase DHX33 OS=Danio rerio OX=7955 GN=si:ch211-160e1.10 PE=1 SV=1
7	PDB:7d63RZ	0.402	0.535	6.122E-57	839	0.302	0.416	7d63RZ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
8	AFDB:Q9VR29	0.505	0.847	1.238E-55	678	0.209	0.357	Q9VR29.pdb.gz	Q9VR29_DROME LD11291p OS=Drosophila melanogaster OX=7227 GN=cg3225 PE=2 SV=2
9	AFDB:Q9H6R0	0.506	0.809	1.517E-55	707	0.213	0.349	Q9H6R0.pdb.gz	DHX33_HUMAN ATP-dependent RNA helicase DHX33 OS=Homo sapiens OX=9606 GN=DHX33 PE=1 SV=2
10	AFDB:F4IJV4	0.514	0.569	1.766E-55	1044	0.248	0.275	F4IJV4.pdb.gz	DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana OX=3702 GN=MEE29 PE=2 SV=1
11	AFDB:Q8VY00	0.506	0.560	3.417E-55	1044	0.221	0.245	Q8VY00.pdb.gz	ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana OX=3702 GN=ESP3 PE=1 SV=1
12	AFDB:Q09530	0.505	0.488	1.044E-54	1200	0.217	0.209	Q09530.pdb.gz	MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans OX=6239 GN=mog-5 PE=1 SV=1
13	AFDB:Q9HYU6	0.508	0.445	2.880E-54	1326	0.214	0.187	Q9HYU6.pdb.gz	Q9HYU6_PSEAE Probable ATP-dependent helicase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA3297 PE=4 SV=1
14	AFDB:Q03319	0.499	0.790	4.109E-54	719	0.209	0.337	Q03319.pdb.gz	PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prh1 PE=3 SV=2
15	PDB:5xjcY	0.499	0.791	3.582E-50	713	0.214	0.348	5xjcY.pdb.gz	An Atomic Structure of the Human Spliceosome
16	PDB:7ajuJD	0.387	0.529	7.669E-50	811	0.286	0.408	7ajuJD.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:6id1V	0.498	0.849	1.410E-49	663	0.196	0.342	6id1V.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
18	PDB:6ff7q	0.482	0.864	2.728E-49	625	0.213	0.395	6ff7q.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:7dcpx	0.483	0.809	3.118E-48	670	0.193	0.333	7dcpx.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
20	PDB:3kx2B	0.501	0.753	4.924E-48	755	0.201	0.309	3kx2B.pdb.gz	Structural basis for the function of DEAH helicases

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8JLP0	0.0	1372	1152	0.571	0.574	B8JLP0_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio OX=7955 GN=fd11d06 PE=1 SV=1
2	Q04217	0.0	608	1267	0.302	0.275	DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ECM16 PE=1 SV=1
3	Q8IY37	0.0	2362	1157	1.000	1.000	DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens OX=9606 GN=DHX37 PE=1 SV=1
4	Q9HDY4	0.0	601	1183	0.309	0.303	YK16_SCHPO Putative ATP-dependent RNA helicase PB1A10.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB1A10.06c PE=3 SV=1
5	Q587C6	4.75e-150	478	1009	0.271	0.311	Q587C6_TRYB2 Pre-mRNA splicing factor ATP-dependent RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.430 PE=4 SV=1
6	F4ILR7	9.25e-72	261	995	0.207	0.241	DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
7	Q8VHK9	1.48e-66	246	1001	0.161	0.186	DHX36_MOUSE ATP-dependent DNA/RNA helicase DHX36 OS=Mus musculus OX=10090 GN=Dhx36 PE=1 SV=2
8	Q8SWT2	2.50e-66	244	942	0.199	0.244	Q8SWT2_DROME GH12763p OS=Drosophila melanogaster OX=7227 GN=Rhau PE=1 SV=1
9	D4A2Z8	4.30e-66	244	1000	0.159	0.184	DHX36_RAT ATP-dependent DNA/RNA helicase DHX36 OS=Rattus norvegicus OX=10116 GN=Dhx36 PE=1 SV=1
10	E7EWK3	4.37e-66	241	797	0.159	0.231	E7EWK3_HUMAN RNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=1
11	Q05B79	8.08e-66	244	1010	0.159	0.182	DHX36_BOVIN ATP-dependent DNA/RNA helicase DHX36 OS=Bos taurus OX=9913 GN=DHX36 PE=1 SV=1
12	Q9H2U1	4.25e-65	241	1008	0.159	0.183	DHX36_HUMAN ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=2
13	Q8VY00	1.10e-63	238	1044	0.130	0.144	ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana OX=3702 GN=ESP3 PE=1 SV=1
14	Q7ZVV8	2.21e-62	234	1054	0.134	0.147	Q7ZVV8_DANRE RNA helicase OS=Danio rerio OX=7955 GN=zgc:55590 PE=1 SV=1
15	Q6P158	4.18e-62	234	1386	0.172	0.144	DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2
16	F4IJV4	5.02e-62	233	1044	0.133	0.148	DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana OX=3702 GN=MEE29 PE=2 SV=1
17	Q38953	1.22e-61	232	1168	0.133	0.132	DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana OX=3702 GN=At3g26560 PE=1 SV=2
18	Q9VIZ3	4.29e-60	225	894	0.130	0.168	Q9VIZ3_DROME LD25692p OS=Drosophila melanogaster OX=7227 GN=l(2)37Cb PE=1 SV=1
19	A2ACQ1	7.01e-60	221	703	0.131	0.215	A2ACQ1_MOUSE RNA helicase OS=Mus musculus OX=10090 GN=Dhx35 PE=1 SV=1
20	A1Z9L3	1.29e-59	226	1242	0.126	0.118	DHX8_DROME ATP-dependent RNA helicase DHX8 OS=Drosophila melanogaster OX=7227 GN=pea PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	3.9e+02	12.8	AAA ATPase domain
2	PF13245 AAA_19	0.35	22.5	AAA domain
3	PF13401 AAA_22	0.016	27.0	AAA domain
4	PF13604 AAA_30	0.66	21.2	AAA domain
5	PF07728 AAA_5	4.2e+02	12.4	AAA domain (dynein-related subfamily)
6	PF06745 ATPase	78	14.1	KaiC
7	PF00270 DEAD	2.4e-06	38.9	DEAD/DEAH box helicase
8	PF09848 DUF2075	2.1e+02	12.6	Schlafen group 3, DNA/RNA helicase domain
9	PF07652 Flavi_DEAD	1.9e+02	13.5	Flavivirus DEAD domain
10	PF04408 HA2	5.2e-25	99.1	Helicase associated domain (HA2)
11	PF00271 Helicase_C	4.3e-06	38.4	Helicase conserved C-terminal domain
12	PF02399 Herpes_ori_bp	1.3e+02	12.1	Origin of replication binding protein
13	PF07717 OB_NTP_bind	9.1e-19	78.9	Oligonucleotide/oligosaccharide-binding (OB)-fold
14	PF04851 ResIII	1.6e+02	13.7	Type III restriction enzyme, res subunit
15	PF00437 T2SSE	86	13.6	Type II/IV secretion system protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311135

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254803	0.999	Something about silencing protein 10
2	9606.ENSP00000328854	0.998	Nucleolar complex protein 4 homolog
3	9606.ENSP00000377944	0.998	U3 small nucleolar RNA-associated protein 14 homolog A
4	9606.ENSP00000244230	0.997	U3 small nucleolar ribonucleoprotein protein MPP10
5	9606.ENSP00000297990	0.997	Nucleolar protein 6
6	9606.ENSP00000405068	0.997	Nucleolar protein 14
7	9606.ENSP00000264279	0.996	Nucleolar protein 58
8	9606.ENSP00000363642	0.996	Ribosome biogenesis protein BMS1 homolog
9	9606.ENSP00000232888	0.995	U3 small nucleolar RNA-interacting protein 2
10	9606.ENSP00000247003	0.995	Probable ATP-dependent RNA helicase DDX49
11	9606.ENSP00000261708	0.995	U3 small nucleolar RNA-associated protein 6 homolog
12	9606.ENSP00000358812	0.995	Protein RRP5 homolog
13	9606.ENSP00000363746	0.994	WD repeat-containing protein 46
14	9606.ENSP00000230640	0.993	Superkiller viralicidic activity 2-like 2
15	9606.ENSP00000297579	0.993	DDB1- and CUL4-associated factor 13
16	9606.ENSP00000327179	0.993	U3 small nucleolar RNA-associated protein 4 homolog
17	9606.ENSP00000423067	0.993	WD repeat-containing protein 36
18	9606.ENSP00000479504	0.991	Probable ATP-dependent RNA helicase DDX52
19	9606.ENSP00000229214	0.990	KRR1 small subunit processome component homolog
20	9606.ENSP00000355541	0.989	HEAT repeat-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0034511	0.998	U3 snoRNA binding
GO:0003824	0.939	catalytic activity
GO:0140640	0.759	catalytic activity, acting on a nucleic acid
GO:0140657	0.738	ATP-dependent activity
GO:0004386	0.519	helicase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.991	regulation of biological process
GO:0009987	0.986	cellular process
GO:0048518	0.908	positive regulation of biological process
GO:0050794	0.724	regulation of cellular process
GO:0071840	0.584	cellular component organization or biogenesis
GO:0022613	0.570	ribonucleoprotein complex biogenesis
GO:0071704	0.562	organic substance metabolic process
GO:0044238	0.535	primary metabolic process
GO:0042254	0.534	ribosome biogenesis
GO:0044237	0.523	cellular metabolic process
GO:0006807	0.509	nitrogen compound metabolic process
GO:0043170	0.469	macromolecule metabolic process
GO:0034641	0.448	cellular nitrogen compound metabolic process
GO:0048522	0.419	positive regulation of cellular process
GO:0010467	0.412	gene expression
GO:0006139	0.410	nucleobase-containing compound metabolic process
GO:0019222	0.394	regulation of metabolic process
GO:0032501	0.387	multicellular organismal process
GO:0060255	0.376	regulation of macromolecule metabolic process
GO:0080090	0.362	regulation of primary metabolic process
GO:0051171	0.362	regulation of nitrogen compound metabolic process
GO:0031323	0.359	regulation of cellular metabolic process
GO:0032502	0.354	developmental process
GO:0090304	0.352	nucleic acid metabolic process
GO:0016070	0.331	RNA metabolic process
GO:0010468	0.327	regulation of gene expression
GO:0019219	0.307	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005654	0.998	nucleoplasm
GO:0005730	0.994	nucleolus
GO:0016020	0.992	membrane
GO:0005737	0.979	cytoplasm
GO:0012505	0.853	endomembrane system
GO:0031975	0.771	envelope
GO:0031967	0.746	organelle envelope
GO:0031090	0.696	organelle membrane
GO:0005635	0.494	nuclear envelope
GO:0032991	0.466	protein-containing complex
GO:0005829	0.429	cytosol
GO:1990904	0.349	ribonucleoprotein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]