StarFunc result for job id Q8IY49

User Input

>input (270 residues)
MFAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFLS
DDDWETISAWIYGLGLCGLFVVSTVFHTISWKKSHLRMVEHCLHMFDRMVIYFFIAASYA
PWLNLRELGPWASHMRWLVWIMASVGTIYVFFFHERTGSCVQFLRGEACPKAGTACLPAR
YKLVELLCYVVMGFFPALVILSMPNTEGIWELVTGGVFYCLGMVFFKSDGRIPFAHAIWH
LFVAFGAGTHYYAIWRYLYLPSTLQTKVSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IY49	1.000	1.000	8.582E-35	270	1.000	1.000	Q8IY49.pdb.gz	PAQRA_HUMAN Monocyte to macrophage differentiation factor 2 OS=Homo sapiens OX=9606 GN=MMD2 PE=1 SV=2
2	AFDB:D3YLD4	0.858	0.952	3.164E-23	243	0.663	0.737	D3YLD4.pdb.gz	D3YLD4_DANRE Monocyte to macrophage differentiation factor 2 OS=Danio rerio OX=7955 GN=mmd2 PE=2 SV=1
3	AFDB:Q15546	0.823	0.931	5.549E-21	238	0.604	0.685	Q15546.pdb.gz	PAQRB_HUMAN Monocyte to macrophage differentiation factor OS=Homo sapiens OX=9606 GN=MMD PE=1 SV=2
4	AFDB:D3YLD5	0.823	0.927	2.315E-20	239	0.578	0.653	D3YLD5.pdb.gz
5	AFDB:A8KB92	0.461	0.473	3.722E-13	263	0.456	0.468	A8KB92.pdb.gz
6	AFDB:P67153	0.701	0.859	1.053E-8	219	0.237	0.292	P67153.pdb.gz	YQFA_ECOLI UPF0073 inner membrane protein YqfA OS=Escherichia coli (strain K12) OX=83333 GN=yqfA PE=1 SV=1
7	AFDB:Q38A44	0.655	0.581	2.810E-6	307	0.174	0.153	Q38A44.pdb.gz	Q38A44_TRYB2 Adiponectin receptor protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1100 PE=4 SV=1
8	AFDB:Q9N536	0.611	0.301	2.954E-5	581	0.167	0.077	Q9N536.pdb.gz	Q9N536_CAEEL Adiponectin receptor protein OS=Caenorhabditis elegans OX=6239 GN=paqr-2 PE=1 SV=2
9	AFDB:Q94177	0.617	0.397	3.351E-5	434	0.159	0.099	Q94177.pdb.gz	ADRL_CAEEL Progestin and adipoQ receptor-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=paqr-1 PE=3 SV=2
10	AFDB:Q9VCY8	0.604	0.383	4.689E-5	444	0.181	0.110	Q9VCY8.pdb.gz	ADRL_DROME Adiponectin receptor protein OS=Drosophila melanogaster OX=7227 GN=AdipoR PE=1 SV=2
11	PDB:6g7oA	0.515	0.412	1.970E-2	350	0.152	0.117	6g7oA.pdb.gz	Structure of a human intramembrane ceramidase explains enzymatic dysfunction found in leukodystrophy.
12	PDB:7f53R	0.413	0.410	7.554E-2	273	0.107	0.106	7f53R.pdb.gz	Structural insights into ligand recognition and activation of the melanocortin-4 receptor.
13	PDB:3aymA	0.421	0.344	9.320E-2	350	0.119	0.091	3aymA.pdb.gz	Crystallographic Analysis of the Primary Photochemical Reaction of Squid Rhodopsin
14	PDB:4djhB	0.148	0.106	1.103E-1	448	0.085	0.051	4djhB.pdb.gz	tructure of the human kappa-opioid receptor in complex with JDTic
15	PDB:7lciR	0.382	0.295	1.304E-1	393	0.148	0.102	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
16	PDB:6nwdA	0.486	0.521	1.609E-1	246	0.093	0.102	6nwdA.pdb.gz	X-ray Crystallographic Structure and Oligomerization of Gloeobacter Rhodopsin.
17	PDB:7f61A	0.400	0.371	1.609E-1	301	0.119	0.106	7f61A.pdb.gz	Structural basis for recognition of antihistamine drug by human histamine receptor.
18	PDB:7jvqR	0.476	0.456	1.904E-1	286	0.130	0.122	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
19	PDB:7e2xR	0.334	0.327	1.985E-1	278	0.133	0.129	7e2xR.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
20	PDB:7drtB	0.446	0.280	2.159E-1	496	0.107	0.058	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IY49	0.0	561	270	1.000	1.000	PAQRA_HUMAN Monocyte to macrophage differentiation factor 2 OS=Homo sapiens OX=9606 GN=MMD2 PE=1 SV=2
2	D3YLD4	5.74e-132	375	243	0.663	0.737	D3YLD4_DANRE Monocyte to macrophage differentiation factor 2 OS=Danio rerio OX=7955 GN=mmd2 PE=2 SV=1
3	Q15546	9.36e-118	338	238	0.611	0.693	PAQRB_HUMAN Monocyte to macrophage differentiation factor OS=Homo sapiens OX=9606 GN=MMD PE=1 SV=2
4	Q32LT2	4.05e-106	309	239	0.563	0.636	Q32LT2_DANRE Monocyte to macrophage differentiation factor OS=Danio rerio OX=7955 GN=zgc:123296 PE=2 SV=1
5	P67153	6.93e-18	82.0	219	0.237	0.292	YQFA_ECOLI UPF0073 inner membrane protein YqfA OS=Escherichia coli (strain K12) OX=83333 GN=yqfA PE=1 SV=1
6	Q38A44	2.2	32.0	307	0.219	0.192	Q38A44_TRYB2 Adiponectin receptor protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1100 PE=4 SV=1
7	Q6ZS10	4.2	31.2	378	0.044	0.032	CL17A_HUMAN C-type lectin domain family 17, member A OS=Homo sapiens OX=9606 GN=CLEC17A PE=1 SV=2
8	Q07791	6.2	30.8	1770	0.074	0.011	YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY2B-DR3 PE=3 SV=1
9	Q93ZH9	6.3	30.4	332	0.111	0.090	HHP1_ARATH Heptahelical transmembrane protein 1 OS=Arabidopsis thaliana OX=3702 GN=HHP1 PE=1 SV=1
10	P0C2I2	6.8	30.8	1755	0.074	0.011	YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY1B-DR5 PE=3 SV=1
11	P0C2I3	6.8	30.8	1755	0.074	0.011	YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY1B-DR6 PE=3 SV=1
12	P0C2I5	6.8	30.8	1755	0.074	0.011	YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY1B-LR2 PE=3 SV=1
13	Q03855	6.8	30.8	1755	0.074	0.011	YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY1B-DR1 PE=3 SV=2
14	Q07793	6.8	30.8	1604	0.074	0.012	YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY1B-DR4 PE=3 SV=2
15	Q12269	6.8	30.8	1755	0.074	0.011	YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY1B-GR2 PE=3 SV=3
16	Q12414	6.8	30.8	1755	0.074	0.011	YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY1B-PL PE=3 SV=1
17	Q99231	6.8	30.8	1755	0.074	0.011	YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY1B-DR3 PE=1 SV=2
18	P0C2J3	7.7	30.8	1770	0.074	0.011	YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY2B-LR1 PE=3 SV=1
19	P0CX63	7.7	30.8	1770	0.074	0.011	YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY2B-F PE=3 SV=1
20	P0CX64	7.7	30.8	1770	0.074	0.011	YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY2B-GR2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03006 HlyIII	9.3e-15	66.5	Haemolysin-III related

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384690

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386881	0.815	Dysferlin
2	9606.ENSP00000315371	0.776	Anoctamin-5
3	9606.ENSP00000037869	0.674	Protein FAM136A
4	9606.ENSP00000406197	0.673	Membrane progestin receptor beta
5	9606.ENSP00000361411	0.645	Zinc finger CCHC-type containing 24
6	9606.ENSP00000347433	0.640	Protein APCDD1
7	9606.ENSP00000405388	0.624	Carbonic anhydrase-related protein 10
8	9606.ENSP00000410007	0.604	F-box only protein 46
9	9606.ENSP00000421981	0.603	Progestin and adipoQ receptor family member 3
10	9606.ENSP00000217971	0.598	Membrane-associated progesterone receptor component 1
11	9606.ENSP00000369681	0.598	Ubiquitin carboxyl-terminal hydrolase 3
12	9606.ENSP00000264436	0.590	Beta-adducin
13	9606.ENSP00000286621	0.557	Adenosine kinase
14	9606.ENSP00000434602	0.555	Uncharacterized protein C6orf141
15	9606.ENSP00000361475	0.542	Neuronal calcium sensor 1
16	9606.ENSP00000363414	0.540	Membrane progestin receptor alpha
17	9606.ENSP00000303686	0.539	Neurotensin receptor type 2
18	9606.ENSP00000295452	0.532	Gamma-aminobutyric acid receptor subunit gamma-1
19	9606.ENSP00000360214	0.532	Opalin
20	9606.ENSP00000200691	0.531	Metallothionein-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0060089	0.926	molecular transducer activity
GO:0038023	0.924	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.976	regulation of cellular process
GO:0048518	0.847	positive regulation of biological process
GO:0045859	0.711	regulation of protein kinase activity
GO:0009966	0.656	regulation of signal transduction
GO:0048522	0.655	positive regulation of cellular process
GO:0033674	0.645	positive regulation of kinase activity
GO:0046578	0.510	regulation of Ras protein signal transduction
GO:0031401	0.405	positive regulation of protein modification process
GO:0032501	0.399	multicellular organismal process
GO:0050793	0.349	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005794	0.999	Golgi apparatus
GO:0031090	0.969	organelle membrane
GO:0005886	0.890	plasma membrane
GO:0098588	0.849	bounding membrane of organelle
GO:0048471	0.775	perinuclear region of cytoplasm
GO:0000139	0.671	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]