StarFunc result for job id Q8IY57

User Input

>input (180 residues)
MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLV
AQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTV
GDLTVIITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IY57	1.000	1.000	4.818E-27	180	1.000	1.000	Q8IY57.pdb.gz	YAF2_HUMAN YY1-associated factor 2 OS=Homo sapiens OX=9606 GN=YAF2 PE=1 SV=3
2	AFDB:Q5SP48	0.376	0.369	1.499E-19	184	0.800	0.783	Q5SP48.pdb.gz	Q5SP48_DANRE YY1-associated factor 2 OS=Danio rerio OX=7955 GN=si:ch211-155a11.5 PE=4 SV=1
3	AFDB:Q8CCI5	0.353	0.296	2.036E-15	228	0.667	0.526	Q8CCI5.pdb.gz	RYBP_MOUSE RING1 and YY1-binding protein OS=Mus musculus OX=10090 GN=Rybp PE=1 SV=1
4	AFDB:Q9W215	0.245	0.287	1.407E-11	150	0.394	0.473	Q9W215.pdb.gz	Q9W215_DROME GEO03726p1 OS=Drosophila melanogaster OX=7227 GN=RYBP PE=2 SV=2
5	AFDB:A0A087WTR9	0.198	0.158	1.689E-1	267	0.133	0.090	A0A087WTR9.pdb.gz	A0A087WTR9_HUMAN MDM4 regulator of p53 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=1
6	AFDB:A0A0R4IVZ0	0.158	0.029	6.521E-1	1436	0.150	0.019	A0A0R4IVZ0.pdb.gz	A0A0R4IVZ0_DANRE Nuclear pore complex protein Nup153 OS=Danio rerio OX=7955 GN=fd23d09 PE=1 SV=1
7	AFDB:Q8GZ43	0.142	0.104	7.373E-1	288	0.150	0.094	Q8GZ43.pdb.gz	YZR3_ARATH RanBP2-type zinc finger protein At1g67325 OS=Arabidopsis thaliana OX=3702 GN=At1g67325 PE=1 SV=1
8	AFDB:P49791	0.159	0.028	7.840E-1	1468	0.217	0.027	P49791.pdb.gz	NU153_RAT Nuclear pore complex protein Nup153 OS=Rattus norvegicus OX=10116 GN=Nup153 PE=1 SV=1
9	AFDB:A2A653	0.131	0.091	1.002	289	0.133	0.083	A2A653.pdb.gz	A2A653_MOUSE Bromodomain PHD finger transcription factor (Fragment) OS=Mus musculus OX=10090 GN=Bptf PE=1 SV=1
10	AFDB:E9PQP7	0.096	0.040	1.133	641	0.161	0.045	E9PQP7.pdb.gz	E9PQP7_HUMAN Protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=1
11	PDB:2v4jB	0.103	0.052	1.766	380	0.022	0.011	2v4jB.pdb.gz	The Crystal Structure of Desulfovibrio Vulgaris Dissimilatory Sulfite Reductase Bound to Dsrc Provides Novel Insights Into the Mechanism of Sulfate Respiration.
12	PDB:7r7jB	0.131	0.042	1.766	574	0.056	0.017	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.
13	PDB:4c2mI	0.089	0.124	3.470	124	0.089	0.129	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
14	PDB:7l08r	0.129	0.142	3.923	162	0.033	0.037	7l08r.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
15	PDB:7o9kC	0.100	0.072	4.171	255	0.028	0.020	7o9kC.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
16	PDB:4v6iBl	0.126	0.206	4.436	88	0.067	0.136	4v6iBl.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
17	PDB:1gotA	0.121	0.068	4.717	338	0.033	0.018	1gotA.pdb.gz	The 2.0 A crystal structure of a heterotrimeric G protein.
18	PDB:4ic1D	0.120	0.105	4.717	206	0.028	0.024	4ic1D.pdb.gz	Toroidal structure and DNA cleavage by the CRISPR-associated [4Fe-4S] cluster containing Cas4 nuclease SSO0001 from Sulfolobus solfataricus.
19	PDB:4m4wO	0.077	0.062	5.015	250	0.022	0.016	4m4wO.pdb.gz
20	PDB:1uptG	0.125	0.132	5.670	170	0.028	0.029	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IY57	7.29e-131	365	180	1.000	1.000	YAF2_HUMAN YY1-associated factor 2 OS=Homo sapiens OX=9606 GN=YAF2 PE=1 SV=3
2	Q99LW6	3.91e-111	316	179	0.894	0.899	YAF2_MOUSE YY1-associated factor 2 OS=Mus musculus OX=10090 GN=Yaf2 PE=1 SV=1
3	Q1JPU4	6.50e-94	272	182	0.828	0.819	Q1JPU4_DANRE YY1-associated factor 2 OS=Danio rerio OX=7955 GN=si:ch211-155a11.5 PE=2 SV=1
4	Q5SP48	2.11e-89	261	184	0.794	0.777	Q5SP48_DANRE YY1-associated factor 2 OS=Danio rerio OX=7955 GN=si:ch211-155a11.5 PE=4 SV=1
5	Q8N488	4.53e-54	173	228	0.639	0.504	RYBP_HUMAN RING1 and YY1-binding protein OS=Homo sapiens OX=9606 GN=RYBP PE=1 SV=2
6	Q8CCI5	4.94e-54	173	228	0.639	0.504	RYBP_MOUSE RING1 and YY1-binding protein OS=Mus musculus OX=10090 GN=Rybp PE=1 SV=1
7	Q9W215	1.73e-34	120	150	0.378	0.453	Q9W215_DROME GEO03726p1 OS=Drosophila melanogaster OX=7227 GN=RYBP PE=2 SV=2
8	A0A8I5YC36	0.002	40.4	3114	0.078	0.004	A0A8I5YC36_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=1
9	D4A054	0.002	40.4	3061	0.078	0.005	D4A054_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=3
10	M0R3M4	0.002	40.4	3089	0.078	0.005	M0R3M4_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=2
11	P49792	0.002	40.4	3224	0.083	0.005	RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2
12	P49791	0.007	38.9	1468	0.083	0.010	NU153_RAT Nuclear pore complex protein Nup153 OS=Rattus norvegicus OX=10116 GN=Nup153 PE=1 SV=1
13	A0A0R4IVZ0	0.013	38.1	1436	0.078	0.010	A0A0R4IVZ0_DANRE Nuclear pore complex protein Nup153 OS=Danio rerio OX=7955 GN=fd23d09 PE=1 SV=1
14	Q9ERU9	0.018	37.7	3053	0.083	0.005	RBP2_MOUSE E3 SUMO-protein ligase RanBP2 OS=Mus musculus OX=10090 GN=Ranbp2 PE=1 SV=2
15	P49790	0.025	37.4	1475	0.067	0.008	NU153_HUMAN Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2
16	Q640Z6	0.027	37.0	1605	0.072	0.008	NU153_XENLA Nuclear pore complex protein Nup153 OS=Xenopus laevis OX=8355 GN=nup153 PE=1 SV=1
17	Q9C7M2	0.035	36.6	849	0.128	0.027	Q9C7M2_ARATH Uncharacterized protein F14C21.55 OS=Arabidopsis thaliana OX=3702 GN=SED1 PE=1 SV=1
18	Q9VXE6	0.047	36.2	1883	0.122	0.012	NU153_DROME Nuclear pore complex protein Nup153 OS=Drosophila melanogaster OX=7227 GN=Nup153 PE=1 SV=4
19	Q9UGI0	0.052	36.2	708	0.083	0.021	ZRAN1_HUMAN Ubiquitin thioesterase ZRANB1 OS=Homo sapiens OX=9606 GN=ZRANB1 PE=1 SV=2
20	F4KI84	0.067	35.8	668	0.172	0.046	F4KI84_ARATH Translation elongation factor EF1A/initiation factor IF2gamma family protein OS=Arabidopsis thaliana OX=3702 GN=HBS1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03107 C1_2	6.4e+02	12.1	C1 domain
2	PF08083 PROCN	42	14.3	PROCN (NUC071) domain
3	PF09422 WTX	76	13.9	WTX protein
4	PF17219 YAF2_RYBP	6.5e-16	68.9	Yaf2/RYBP C-terminal binding motif
5	PF00641 zf-RanBP	3.4e-05	34.4	Zn-finger in Ran binding protein and others

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 132908.ENSPVAP00000015877

Rank	PPI partner	STRING score	Description
1	132908.ENSPVAP00000005628	0.966	Ring finger protein 2
2	132908.ENSPVAP00000001791	0.950	Ring finger protein 1
3	132908.ENSPVAP00000011371	0.933	Polycomb group ring finger 5
4	132908.ENSPVAP00000007009	0.901	Autism susceptibility candidate 2
5	132908.ENSPVAP00000003947	0.876	Polycomb group ring finger 6
6	132908.ENSPVAP00000003685	0.871	BCL6 corepressor
7	132908.ENSPVAP00000007296	0.853	annotation not available
8	132908.ENSPVAP00000010930	0.850	Chromobox homolog 2
9	132908.ENSPVAP00000013166	0.835	Polycomb group ring finger 1
10	132908.ENSPVAP00000004373	0.832	Casein kinase 2, alpha prime polypeptide
11	132908.ENSPVAP00000009675	0.827	Lysine (K)-specific demethylase 2B
12	132908.ENSPVAP00000008170	0.808	E2F transcription factor 6
13	132908.ENSPVAP00000008067	0.807	Lysine (K)-specific demethylase 2A
14	132908.ENSPVAP00000010412	0.794	F-box and leucine-rich repeat protein 19
15	132908.ENSPVAP00000010933	0.792	Chromobox homolog 8
16	132908.ENSPVAP00000002145	0.786	Polycomb group ring finger 2
17	132908.ENSPVAP00000012048	0.784	L(3)mbt-like 2 (Drosophila)
18	132908.ENSPVAP00000009576	0.781	Chromobox homolog 6
19	132908.ENSPVAP00000016565	0.781	Polycomb group ring finger 3
20	132908.ENSPVAP00000011492	0.754	Polyhomeotic homolog 1 (Drosophila)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003714	1.000	transcription corepressor activity
GO:0003713	0.991	transcription coactivator activity
GO:0003676	0.675	nucleic acid binding
GO:0003677	0.412	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0048523	0.977	negative regulation of cellular process
GO:0048518	0.825	positive regulation of biological process
GO:0048522	0.785	positive regulation of cellular process
GO:0031323	0.779	regulation of cellular metabolic process
GO:0051172	0.777	negative regulation of nitrogen compound metabolic process
GO:0009987	0.758	cellular process
GO:0010605	0.758	negative regulation of macromolecule metabolic process
GO:0009889	0.740	regulation of biosynthetic process
GO:0080090	0.736	regulation of primary metabolic process
GO:0010468	0.736	regulation of gene expression
GO:0031326	0.726	regulation of cellular biosynthetic process
GO:0019219	0.726	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.725	regulation of macromolecule biosynthetic process
GO:0006355	0.716	regulation of DNA-templated transcription
GO:0045892	0.675	negative regulation of DNA-templated transcription
GO:0051173	0.670	positive regulation of nitrogen compound metabolic process
GO:0010557	0.593	positive regulation of macromolecule biosynthetic process
GO:0032502	0.526	developmental process
GO:0048856	0.521	anatomical structure development
GO:0031325	0.462	positive regulation of cellular metabolic process
GO:0031328	0.446	positive regulation of cellular biosynthetic process
GO:0071840	0.393	cellular component organization or biogenesis
GO:0016043	0.384	cellular component organization
GO:0045935	0.330	positive regulation of nucleobase-containing compound metabolic process
GO:0048513	0.314	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.938	cytoplasm
GO:0005829	0.889	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]