StarFunc result for job id Q8IY81

User Input

>input (847 residues)
MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQFLQKARALLDLCAAPGGWLQ
VAAKFMPVSSLIVGVDLVPIKPLPNVVTLQQDITTERCRQALRKELKTWKVDVVLNDGAP
NVGASWVHDAYSQAHLTLMALRLACDFLARGGSFITKVFRSRDYQPLLWIFQQLFRRVQA
TKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEVQAKTVTELVTKKKPKAEG
YAEGDLTLYHRTSVTDFLRAANPVDFLSKASEIMVDDEELAQHPATTEDIRVCCQDIRVL
GRKELRSLLNWRTKLRRYVAKKLKEQAKALDISLSSGEEDEGDEEDSTAGTTKQPSKEEE
EEEEEEQLNQTLAEMKAQEVAELKRKKKKLLREQRKQRERVELKMDLPGVSIADEGETGM
FSLSTIRGHQLLEEVTQGDMSAADTFLSDLPRDDIYVSDVEDDGDDTSLDSDLDPEELAG
VRGHQGLRDQKRMRLTEVQDDKEEEEEENPLLVPLEEKAVLQEEQANLWFSKGSFAGIED
DADEALEISQAQLLFENRRKGRQQQQKQQLPQTPPSCLKTEIMSPLYQDEAPKGTEASSG
TEAATGLEGEEKDGISDSDSSTSSEEEESWEPLRGKKRSRGPKSDDDGFEIVPIEDPAKH
RILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIRQLPVG
KKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNTVDISEREKVA
QLRSLYKKAGLGKEKRHVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQQRKEQ
KKKHKRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IY81	1.000	1.000	0.000	847	1.000	1.000	Q8IY81.pdb.gz	SPB1_HUMAN pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2
2	AFDB:O42832	0.284	0.299	5.550E-65	802	0.370	0.390	O42832.pdb.gz	SPB1_SCHPO AdoMet-dependent rRNA methyltransferase spb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spb1 PE=1 SV=2
3	AFDB:P25582	0.313	0.315	2.699E-61	841	0.359	0.361	P25582.pdb.gz	SPB1_YEAST 27S pre-rRNA (guanosine(2922)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPB1 PE=1 SV=2
4	AFDB:F4JTD2	0.296	0.304	3.105E-60	821	0.342	0.353	F4JTD2.pdb.gz	F4JTD2_ARATH Putative rRNA methyltransferase OS=Arabidopsis thaliana OX=3702 GN=TRM7B PE=1 SV=1
5	PDB:7nacw	0.263	0.327	5.108E-50	672	0.315	0.397	7nacw.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
6	AFDB:Q586Q7	0.276	0.259	2.060E-49	905	0.313	0.293	Q586Q7.pdb.gz	Q586Q7_TRYB2 Putative rRNA methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.305 PE=3 SV=1
7	PDB:6elzw	0.240	0.452	4.045E-36	436	0.255	0.495	6elzw.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
8	PDB:6ylxw	0.238	0.530	1.298E-28	360	0.166	0.392	6ylxw.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
9	AFDB:O36015	0.238	0.682	3.518E-23	285	0.107	0.319	O36015.pdb.gz	TRM7_SCHPO tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm7 PE=1 SV=1
10	AFDB:Q9UET6	0.238	0.593	1.269E-22	329	0.106	0.274	Q9UET6.pdb.gz	TRM7_HUMAN tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens OX=9606 GN=FTSJ1 PE=1 SV=2
11	AFDB:P38238	0.239	0.626	7.926E-22	310	0.112	0.306	P38238.pdb.gz	TRM7_YEAST tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRM7 PE=1 SV=1
12	AFDB:Q9VEP1	0.234	0.640	1.373E-21	302	0.086	0.242	Q9VEP1.pdb.gz	TRM71_DROME tRNA (cytidine(32)-2'-O)-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Trm7-32 PE=1 SV=1
13	AFDB:Q9VDD9	0.249	0.638	2.239E-21	320	0.115	0.303	Q9VDD9.pdb.gz	TRM72_DROME tRNA (guanosine(34)-2'-O)-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Trm7-34 PE=1 SV=1
14	PDB:6jplB	0.222	0.787	5.317E-21	231	0.103	0.377	6jplB.pdb.gz	Structure of tRNA methyltransferase complex of Trm7 and Trm734 reveals a novel binding interface for tRNA recognition.
15	PDB:7o9mn	0.221	0.847	1.870E-18	215	0.083	0.326	7o9mn.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
16	PDB:4by9E	0.145	0.503	8.093E-8	227	0.032	0.119	4by9E.pdb.gz	The Structure of the Box C/D Enzyme Reveals Regulation of RNA Methylation.
17	PDB:5ginE	0.157	0.533	3.505E-7	227	0.034	0.128	5ginE.pdb.gz	Box C/D guide RNAs recognize a maximum of 10 nt of substrates
18	PDB:6u1xA	0.159	0.069	1.264E-6	2059	0.040	0.017	6u1xA.pdb.gz	Structure of the Vesicular Stomatitis Virus L Protein in Complex with Its Phosphoprotein Cofactor.
19	PDB:1sqfA	0.150	0.277	1.428E-6	425	0.039	0.078	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
20	PDB:3a4tA	0.167	0.486	1.428E-6	258	0.038	0.124	3a4tA.pdb.gz	Crystal structure of Methanocaldococcus jannaschii Trm4 complexed with sinefungin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IY81	0.0	1725	847	1.000	1.000	SPB1_HUMAN pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2
2	P25582	1.87e-118	381	841	0.233	0.234	SPB1_YEAST 27S pre-rRNA (guanosine(2922)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPB1 PE=1 SV=2
3	F4JTD2	4.91e-92	310	821	0.205	0.212	F4JTD2_ARATH Putative rRNA methyltransferase OS=Arabidopsis thaliana OX=3702 GN=TRM7B PE=1 SV=1
4	Q586Q7	5.44e-84	290	905	0.178	0.167	Q586Q7_TRYB2 Putative rRNA methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.305 PE=3 SV=1
5	Q9UET6	5.13e-44	164	329	0.115	0.295	TRM7_HUMAN tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens OX=9606 GN=FTSJ1 PE=1 SV=2
6	O36015	4.13e-43	160	285	0.102	0.302	TRM7_SCHPO tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm7 PE=1 SV=1
7	P38238	4.31e-43	161	310	0.106	0.290	TRM7_YEAST tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRM7 PE=1 SV=1
8	Q9VDD9	2.39e-37	144	320	0.097	0.256	TRM72_DROME tRNA (guanosine(34)-2'-O)-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Trm7-34 PE=1 SV=1
9	O42832	2.82e-33	140	802	0.105	0.111	SPB1_SCHPO AdoMet-dependent rRNA methyltransferase spb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spb1 PE=1 SV=2
10	Q9VEP1	2.88e-32	129	302	0.087	0.245	TRM71_DROME tRNA (cytidine(32)-2'-O)-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Trm7-32 PE=1 SV=1
11	P0C0R7	2.97e-28	115	209	0.077	0.311	RLME_ECOLI Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain K12) OX=83333 GN=rlmE PE=1 SV=1
12	Q9UI43	2.04e-22	99.4	246	0.083	0.285	MRM2_HUMAN rRNA methyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=MRM2 PE=1 SV=1
13	Q9CPY0	5.72e-22	98.2	246	0.079	0.272	MRM2_MOUSE rRNA methyltransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Mrm2 PE=1 SV=1
14	P78860	2.15e-21	95.9	218	0.076	0.294	MRM2_SCHPO rRNA methyltransferase 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrm2 PE=2 SV=2
15	Q9VDT6	1.55e-18	88.2	250	0.070	0.236	MRM2_DROME rRNA methyltransferase 2, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CG11447 PE=2 SV=1
16	Q57Y21	1.16e-15	80.5	284	0.081	0.243	Q57Y21_TRYB2 rRNA methyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.360 PE=4 SV=1
17	P53123	5.93e-11	67.0	320	0.041	0.109	MRM2_YEAST rRNA methyltransferase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRM2 PE=1 SV=1
18	Q38AH0	0.058	39.3	370	0.026	0.059	MTR1_TRYB2 Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=MTR1 PE=1 SV=1
19	Q9UAS6	0.12	38.5	700	0.037	0.044	CMTR2_DROME Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2 OS=Drosophila melanogaster OX=7227 GN=cmtr2 PE=2 SV=2
20	Q8TFH4	0.20	37.4	301	0.018	0.050	YIKA_SCHPO Putative ribosomal RNA methyltransferase PB17E12.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB17E12.10c PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11861 DUF3381	1.5e-44	163.2	Domain of unknown function (DUF3381)
2	PF01728 FtsJ	1.7e-52	189.7	FtsJ-like methyltransferase
3	PF08367 M16C_assoc	18	15.9	Peptidase M16C associated
4	PF13489 Methyltransf_23	2.9e+02	12.7	Methyltransferase domain
5	PF07780 Spb1_C	3e-68	241.2	Spb1 C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000396673

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264279	0.999	Nucleolar protein 58
2	9606.ENSP00000285814	0.999	Nucleolar protein interacting with the FHA domain of MKI67
3	9606.ENSP00000370589	0.998	Nucleolar protein 56
4	9606.ENSP00000371858	0.998	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
5	9606.ENSP00000407323	0.998	Probable rRNA-processing protein EBP2
6	9606.ENSP00000483484	0.998	Ribosome biogenesis protein NSA2 homolog
7	9606.ENSP00000221801	0.997	rRNA 2'-O-methyltransferase fibrillarin
8	9606.ENSP00000364320	0.997	mRNA turnover protein 4 homolog
9	9606.ENSP00000346725	0.996	Pescadillo homolog
10	9606.ENSP00000353246	0.996	Protein MAK16 homolog
11	9606.ENSP00000377944	0.996	U3 small nucleolar RNA-associated protein 14 homolog A
12	9606.ENSP00000454836	0.994	Transducin beta-like protein 3
13	9606.ENSP00000455106	0.994	Ribosome biogenesis protein BOP1
14	9606.ENSP00000254940	0.993	60S ribosome subunit biogenesis protein NIP7 homolog
15	9606.ENSP00000322396	0.993	Ribosome biogenesis regulatory protein homolog
16	9606.ENSP00000358812	0.993	Protein RRP5 homolog
17	9606.ENSP00000247003	0.992	Probable ATP-dependent RNA helicase DDX49
18	9606.ENSP00000405068	0.992	Nucleolar protein 14
19	9606.ENSP00000432119	0.992	WD repeat-containing protein 74
20	9606.ENSP00000225298	0.991	U3 small nucleolar RNA-associated protein 18 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0062105	1.000	RNA 2'-O-methyltransferase activity
GO:0008757	0.680	S-adenosylmethionine-dependent methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0034641	0.993	cellular nitrogen compound metabolic process
GO:0016070	0.976	RNA metabolic process
GO:0044260	0.959	cellular macromolecule metabolic process
GO:0009451	0.935	RNA modification
GO:0043414	0.918	macromolecule methylation
GO:0001510	0.902	RNA methylation
GO:0010467	0.475	gene expression
GO:0065007	0.447	biological regulation
GO:0071840	0.442	cellular component organization or biogenesis
GO:0050789	0.435	regulation of biological process
GO:0006396	0.422	RNA processing
GO:0034660	0.400	ncRNA metabolic process
GO:0050794	0.399	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0005654	0.999	nucleoplasm
GO:0005694	0.992	chromosome
GO:0005737	0.537	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58956	1.000	a ribonucleotide in RNA + S-adenosyl-L-methionine = a 2'-O-methylribonucleotide in RNA + H(+) + S-adenosyl-L-homocysteine

[back to server]