StarFunc result for job id Q8IY85

User Input

>input (973 residues)
METKVHLFCQAEENIDLLDDGSNSFATDLSSGTINHKKYIKFSKTIEKEISPEIRSLSPE
YKKIFETSIIFCGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENS
LCKLPNQYSVHKTSSPLCTSSAITREKEMLSNLYMTLYDEVTHGYLHSKELSALHKACKI
FSKIRSGKIYVNDLPVILCILRISISDLEMRQALKTVDIDAFQDALKIFCRIKGGRVSTD
DVFAVLDSMGIPINREILEEVTKHTYIDSNHMVDIGDIIFTLNELQEQYEDVSITEGSPL
NEITSDRKLSSVAGCYLKYKKKNSLSSKLPEPSISKKLNKKSNQYYSKIMENDDLESKRP
KNTWQIRKFLGGVGSSNVGVQEPYSKNGINFKKHSEKGEIHDSKSKPQSLKSSTSLSKSL
DKSDISSIPKLQKPAVRKHSSLQKQVSSTEKTAISTLENFCEAISKLQENYIAAEELQSI
LPSTGINLLDEEFQKIVTDTSRNENGMVELDDFVNALAKERSFPECNALPGVIKAIDKIK
DKNVDYEDLNTCLQNFGIYLSKPEFKKITELTEAGETKKVNFKEFIDTMMSNTECFSEKL
VLPDAIETLDDLRKETMSVSDLWNTLSSLNSNLKKDEFLAALELVTVDEGDKVQFEEFAK
VVRNMRDAARLEELQEVVLAADLLEGDMIAGKNLEDFLRNVGIKSPKEEVEKILQSDFVS
EDNMVNIKDCMRALRDTQKFSNYIDFRKEASNLKLPKVNEIKEAANILSHVDNGKIGIPD
LEHALKCLNVNLTEEDFNEALNCCNVSDNMEVDLKDFLMKMKESPHFQKSKATQILLATT
QILQNDLVDVSDLKTLLMDKDLHTANAILTVMLRHVPEHESGKVSIQEFMTKLSDILTIP
KAAGKFYLICTYCPDLERQAVVYMLKTIQDSIVKAQVSKKQYNMNIKQHKISLHNFCLNS
KANIAKLNPNSKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F4JCC1	0.062	0.061	1.381E-4	992	0.135	0.132	F4JCC1.pdb.gz	PR40B_ARATH Pre-mRNA-processing protein 40B OS=Arabidopsis thaliana OX=3702 GN=PRP40B PE=1 SV=1
2	PDB:2n6aA	0.059	0.266	9.939E-4	162	0.027	0.160	2n6aA.pdb.gz	An investigation of calcium mediate signaling by the Connexin 36 gap junction protein
3	PDB:5a2hA	0.073	0.284	1.087E-3	147	0.032	0.211	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
4	PDB:5d43A	0.061	0.326	1.361E-3	150	0.032	0.207	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
5	PDB:3fwbA	0.061	0.300	2.442E-3	153	0.024	0.150	3fwbA.pdb.gz
6	PDB:4e53A	0.076	0.274	2.671E-3	168	0.038	0.220	4e53A.pdb.gz
7	PDB:2lhiA	0.070	0.269	2.923E-3	176	0.030	0.165	2lhiA.pdb.gz	Solution structures of yeast Saccharomyces cerevisiae calmodulin in calcium- and target peptide-bound states reveal similarities and differences to vertebrate calmodulin.
8	PDB:1osaA	0.068	0.267	4.791E-3	148	0.031	0.203	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
9	PDB:3qrxA	0.075	0.309	5.012E-3	145	0.028	0.186	3qrxA.pdb.gz	The structure, molecular dynamics, and energetics of centrin-melittin complex.
10	PDB:1hqvA	0.060	0.251	7.180E-3	178	0.029	0.157	1hqvA.pdb.gz	Structure of apoptosis-linked protein ALG-2: insights into Ca2+-induced changes in penta-EF-hand proteins.
11	PDB:1ggzA	0.075	0.310	7.510E-3	144	0.031	0.208	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
12	AFDB:Q08562	0.061	0.048	1.236E-2	1619	0.118	0.071	Q08562.pdb.gz	ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULS1 PE=1 SV=1
13	AFDB:Q9BL68	0.069	0.060	1.619E-2	1241	0.128	0.101	Q9BL68.pdb.gz	Q9BL68_CAEEL PIN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-6 PE=1 SV=3
14	AFDB:A0A2R8QD21	0.063	0.038	1.693E-2	1989	0.138	0.067	A0A2R8QD21.pdb.gz
15	AFDB:Q585G4	0.083	0.082	3.801E-2	988	0.112	0.110	Q585G4.pdb.gz	Q585G4_TRYB2 Pumilio/PUF RNA binding protein 4, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.50 PE=4 SV=1
16	AFDB:P25339	0.068	0.072	4.550E-2	888	0.102	0.111	P25339.pdb.gz	PUF4_YEAST Pumilio homology domain family member 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUF4 PE=1 SV=2
17	AFDB:F4HWC3	0.056	0.047	6.818E-2	1364	0.126	0.090	F4HWC3.pdb.gz	F4HWC3_ARATH Calponin-like domain protein OS=Arabidopsis thaliana OX=3702 GN=At1g20970 PE=1 SV=1
18	AFDB:Q8NDZ2	0.058	0.062	7.132E-2	872	0.105	0.117	Q8NDZ2.pdb.gz	SIMC1_HUMAN SUMO-interacting motif-containing protein 1 OS=Homo sapiens OX=9606 GN=SIMC1 PE=1 SV=3
19	AFDB:A0A803JG39	0.078	0.071	7.802E-2	1129	0.153	0.132	A0A803JG39.pdb.gz	A0A803JG39_XENTR Protein phosphatase 2 regulatory subunit B''alpha OS=Xenopus tropicalis OX=8364 GN=ppp2r3a PE=4 SV=1
20	AFDB:Q06190	0.081	0.073	8.161E-2	1150	0.137	0.116	Q06190.pdb.gz	P2R3A_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha OS=Homo sapiens OX=9606 GN=PPP2R3A PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P06787	9.12e-07	51.6	147	0.041	0.272	CALM_YEAST Calmodulin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CMD1 PE=1 SV=1
2	Q9NZT1	2.61e-05	47.4	146	0.029	0.192	CALL5_HUMAN Calmodulin-like protein 5 OS=Homo sapiens OX=9606 GN=CALML5 PE=1 SV=2
3	O23320	2.68e-05	47.4	151	0.037	0.238	CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana OX=3702 GN=CML8 PE=1 SV=1
4	F4K8M2	2.85e-05	47.8	175	0.032	0.177	F4K8M2_ARATH Calmodulin 1 OS=Arabidopsis thaliana OX=3702 GN=CAM1 PE=4 SV=1
5	P04464	1.01e-04	45.8	149	0.033	0.215	CALM_WHEAT Calmodulin OS=Triticum aestivum OX=4565 PE=1 SV=3
6	Q03509	1.85e-04	45.1	149	0.033	0.215	CALM6_ARATH Calmodulin-6 OS=Arabidopsis thaliana OX=3702 GN=CAM6 PE=1 SV=2
7	F4IVN6	2.20e-04	45.4	181	0.032	0.171	F4IVN6_ARATH Calmodulin 5 OS=Arabidopsis thaliana OX=3702 GN=CAM5 PE=1 SV=1
8	P0DH95	2.34e-04	44.7	149	0.033	0.215	CALM1_ARATH Calmodulin-1 OS=Arabidopsis thaliana OX=3702 GN=CAM1 PE=1 SV=1
9	P05434	2.39e-04	45.1	169	0.047	0.272	CATR_CHLRE Caltractin OS=Chlamydomonas reinhardtii OX=3055 PE=1 SV=1
10	Q9S9V0	2.45e-04	47.4	484	0.041	0.083	CDPKV_ARATH Calcium-dependent protein kinase 31 OS=Arabidopsis thaliana OX=3702 GN=CPK31 PE=2 SV=2
11	P13868	2.73e-04	44.7	149	0.033	0.215	CALM1_SOLTU Calmodulin-1 OS=Solanum tuberosum OX=4113 GN=PCM1 PE=1 SV=2
12	P0DH97	4.11e-04	43.9	149	0.032	0.208	CALM2_ARATH Calmodulin-2 OS=Arabidopsis thaliana OX=3702 GN=CAM2 PE=1 SV=1
13	P0DH98	4.11e-04	43.9	149	0.032	0.208	CALM3_ARATH Calmodulin-3 OS=Arabidopsis thaliana OX=3702 GN=CAM3 PE=1 SV=1
14	Q682T9	4.11e-04	43.9	149	0.032	0.208	CALM5_ARATH Calmodulin-5 OS=Arabidopsis thaliana OX=3702 GN=CAM5 PE=1 SV=1
15	F4IEU4	4.17e-04	44.3	159	0.028	0.170	F4IEU4_ARATH Calmodulin 4 OS=Arabidopsis thaliana OX=3702 GN=CAM4 PE=4 SV=1
16	P59220	4.31e-04	43.9	149	0.032	0.208	CALM7_ARATH Calmodulin-7 OS=Arabidopsis thaliana OX=3702 GN=CAM7 PE=1 SV=2
17	P62199	4.31e-04	43.9	149	0.032	0.208	CALM1_PETHY Calmodulin-1 OS=Petunia hybrida OX=4102 GN=CAM81 PE=1 SV=2
18	O82659	5.43e-04	43.9	169	0.038	0.219	CML20_ARATH Probable calcium-binding protein CML20 OS=Arabidopsis thaliana OX=3702 GN=CML20 PE=1 SV=1
19	F4IJ46	7.23e-04	43.5	161	0.027	0.161	F4IJ46_ARATH Calmodulin 2 OS=Arabidopsis thaliana OX=3702 GN=CAM2 PE=4 SV=1
20	Q38EV6	0.001	42.7	157	0.034	0.210	Q38EV6_TRYB2 Calmodulin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4520 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08976 EF-hand_11	0.23	23.7	EF-hand domain
2	PF13499 EF-hand_7	0.00026	32.7	EF-hand domain pair
3	PF13833 EF-hand_8	1.4	20.0	EF-hand domain pair

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332111

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000403932	0.811	EF-hand calcium-binding domain-containing protein 3
2	9606.ENSP00000465589	0.730	Long-chain-fatty-acid--CoA ligase ACSBG2
3	9606.ENSP00000353590	0.621	Myosin-10
4	9606.ENSP00000229595	0.608	Histone chaperone ASF1A
5	9606.ENSP00000310704	0.583	Olfactory receptor 10H5
6	9606.ENSP00000258873	0.573	Long-chain-fatty-acid--CoA ligase ACSBG1
7	9606.ENSP00000323355	0.560	Protein FAM187B
8	9606.ENSP00000480336	0.551	Solute carrier family 22 member 24
9	9606.ENSP00000335596	0.549	Olfactory receptor 10H1
10	9606.ENSP00000410111	0.540	TBC1 domain family member 26
11	9606.ENSP00000339973	0.537	TBC1 domain family member 28
12	9606.ENSP00000382000	0.520	CMT1A duplicated region transcript 15 like 2
13	9606.ENSP00000437812	0.519	Protein FAM106A
14	9606.ENSP00000446902	0.517	Nuclear pore complex interacting protein family member B9
15	9606.ENSP00000309189	0.506	Spermatid-associated protein
16	9606.ENSP00000333802	0.505	Zinc finger protein 599
17	9606.ENSP00000417192	0.503	Zinc finger protein 80

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.773	ion binding
GO:0005509	0.697	calcium ion binding
GO:0003824	0.350	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0065007	0.381	biological regulation
GO:0050789	0.366	regulation of biological process
GO:0050794	0.342	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005634	0.942	nucleus
GO:0016020	0.850	membrane
GO:0005737	0.722	cytoplasm
GO:0043232	0.651	intracellular non-membrane-bounded organelle
GO:0031974	0.643	membrane-enclosed lumen
GO:0043233	0.582	organelle lumen
GO:0070013	0.516	intracellular organelle lumen
GO:0005886	0.423	plasma membrane
GO:0031981	0.330	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]