StarFunc result for job id Q8IY92

User Input

>input (1834 residues)
MKLSVNEAQLGFYLGSLSHLSACPGIDPRSSEDQPESLKTGQMMDESDEDFKELCASFFQ
RVKKHGIKEVSGERKTQKAASNGTQIRSKLKRTKQTATKTKTLQGPAEKKPPSGSQAPRT
KKQRVTKWQASEPAHSVNGEGGVLASAPDPPVLRETAQNTQTGNQQEPSPNLSREKTREN
VPNSDSQPPPSCLTTAVPSPSKPRTAQLVLQRMQQFKRADPERLRHASEECSLEAAREEN
VPKDPQEEMMAGNVYGLGPPAPESDAAVALTLQQEFARVGASAHDDSLEEKGLFFCQICQ
KNLSAMNVTRREQHVNRCLDEAEKTLRPSVPQIPECPICGKPFLTLKSRTSHLKQCAVKM
EVGPQLLLQAVRLQTAQPEGSSSPPMFSFSDHSRGLKRRGPTSKKEPRKRRKVDEAPSED
LLVAMALSRSEMEPGAAVPALRLESAFSERIRPEAENKSRKKKPPVSPPLLLVQDSETTG
RQIEDRVALLLSEEVELSSTPPLPASRILKEGWERAGQCPPPPERKQSFLWEGSALTGAW
AMEDFYTARLVPPLVPQRPAQGLMQEPVPPLVPPEHSELSERRSPALHGTPTAGCGSRGP
SPSASQREHQALQDLVDLAREGLSASPWPGSGGLAGSEGTAGLDVVPGGLPLTGFVVPSQ
DKHPDRGGRTLLSLGLLVADFGAMVNNPHLSDVQFQTDSGEVLYAHKFVLYARCPLLIQY
VNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVS
ELVHLCEQVPIATDSEGKPWEEKEAENCESRAENFQELLRSMWADEEEEAETLLKSKDHE
EDQENVNEAEMEEIYEFAATQRKLLQEERAAGAGEDADWLEGGSPVSGQLLAGVQVQKQW
DKVEEMEPLEPGRDEAATTWEKMGQCALPPPQGQHSGARGAEAPEQEAPEEALGHSSCSS
PSRDCQAERKEGSLPHSDDAGDYEQLFSSTQGEISEPSQITSEPEEQSGAVRERGLEVSH
RLAPWQASPPHPCRFLLGPPQGGSPRGSHHTSGSSLSTPRSRGGTSQVGSPTLLSPAVPS
KQKRDRSILTLSKEPGHQKGKERRSVLECRNKGVLMFPEKSPSIDLTQSNPDHSSSRSQK
SSSKLNEEDEVILLLDSDEELELEQTKMKSISSDPLEEKKALEISPRSCELFSIIDVDAD
QEPSQSPPRSEAVLQQEDEGALPENRGSLGRRGAPWLFCDRESSPSEASTTDTSWLVPAT
PLASRSRDCSSQTQISSLRSGLAVQAVTQHTPRASVGNREGNEVAQKFSVIRPQTPPPQT
PSSCLTPVSPGTSDGRRQGHRSPSRPHPGGHPHSSPLAPHPISGDRAHFSRRFLKHSPPG
PSFLNQTPAGEVVEVGDSDDEQEVASHQANRSPPLDSDPPIPIDDCCWHMEPLSPIPIDH
WNLERTGPLSTSSPSRRMNEAADSRDCRSPGLLDTTPIRGSCTTQRKLQEKSSGAGSLGN
SRPSFLNSALWDVWDGEEQRPPETPPPAQMPSAGGAQKPEGLETPKGANRKKNLPPKVPI
TPMPQYSIMETPVLKKELDRFGVRPLPKRQMVLKLKEIFQYTHQTLDSDSEDESQSSQPL
LQAPHCQTLASQTYKPSRAGVHAQQEATTGPGAHRPKGPAKTKGPRHQRKHHESITPPSR
SPTKEAPPGLNDDAQIPASQESVATSVDGSDSSLSSQSSSSCEFGAAFESAGEEEGEGEV
SASQAAVQAADTDEALRCYIRSKPALYQKVLLYQPFELRELQAELRQNGLRVSSRRLLDF
LDTHCITFTTAATRREKLQGRRRQPRGKKKVERN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P1D7	0.218	0.249	0.000	1565	0.518	0.607	Q6P1D7.pdb.gz	SLX4_MOUSE Structure-specific endonuclease subunit SLX4 OS=Mus musculus OX=10090 GN=Slx4 PE=1 SV=1
2	AFDB:Q8IY92	1.000	1.000	0.000	1834	1.000	1.000	Q8IY92.pdb.gz	SLX4_HUMAN Structure-specific endonuclease subunit SLX4 OS=Homo sapiens OX=9606 GN=SLX4 PE=1 SV=3
3	AFDB:P10071	0.031	0.035	5.255E-8	1580	0.133	0.154	P10071.pdb.gz	GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=6
4	AFDB:P35658	0.028	0.025	1.658E-7	2090	0.147	0.129	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
5	AFDB:Q61602	0.033	0.036	2.625E-7	1583	0.133	0.154	Q61602.pdb.gz	GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus OX=10090 GN=Gli3 PE=1 SV=2
6	AFDB:Q80U93	0.033	0.032	2.625E-7	2085	0.149	0.131	Q80U93.pdb.gz	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2
7	AFDB:H6D7E6	0.029	0.032	2.780E-7	1554	0.140	0.165	H6D7E6.pdb.gz	TALD3_DANRE Protein TALPID3 OS=Danio rerio OX=7955 GN=talpid3 PE=2 SV=1
8	AFDB:Q9BVV6	0.031	0.037	2.780E-7	1533	0.132	0.158	Q9BVV6.pdb.gz	TALD3_HUMAN Protein TALPID3 OS=Homo sapiens OX=9606 GN=KIAA0586 PE=1 SV=4
9	AFDB:Q6ZU65	0.037	0.042	5.231E-7	1347	0.121	0.164	Q6ZU65.pdb.gz	UBN2_HUMAN Ubinuclein-2 OS=Homo sapiens OX=9606 GN=UBN2 PE=1 SV=2
10	AFDB:Q6P5H2	0.033	0.032	6.214E-7	1864	0.132	0.130	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
11	PDB:6wcqC	0.049	0.616	1.666E-3	130	0.010	0.146	6wcqC.pdb.gz
12	PDB:7mk2A	0.061	0.292	3.944E-3	354	0.016	0.085	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
13	PDB:2p1nD	0.047	0.492	9.843E-2	127	0.011	0.165	2p1nD.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
14	PDB:6r7fQ	0.042	0.482	3.483E-1	112	0.008	0.134	6r7fQ.pdb.gz
15	PDB:7pmkX	0.026	0.054	1.740	665	0.014	0.039	7pmkX.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
16	PDB:6sgaFS	0.041	0.242	2.456	277	0.010	0.065	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
17	PDB:3lutB	0.042	0.172	4.894	390	0.011	0.051	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
18	PDB:6govN	0.020	0.154	4.894	110	0.011	0.182	6govN.pdb.gz	Structural Basis for the Action of an All-Purpose Transcription Anti-termination Factor.
19	PDB:4behB	0.019	0.184	5.490	116	0.008	0.121	4behB.pdb.gz
20	PDB:4dgkA	0.023	0.069	6.158	405	0.008	0.037	4dgkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P1D7	0.0	1567	1565	0.523	0.613	SLX4_MOUSE Structure-specific endonuclease subunit SLX4 OS=Mus musculus OX=10090 GN=Slx4 PE=1 SV=1
2	Q8IY92	0.0	3713	1834	1.000	1.000	SLX4_HUMAN Structure-specific endonuclease subunit SLX4 OS=Homo sapiens OX=9606 GN=SLX4 PE=1 SV=3
3	F1QPU2	2.92e-93	338	1719	0.176	0.187	F1QPU2_DANRE Structure-specific endonuclease subunit SLX4 OS=Danio rerio OX=7955 GN=slx4 PE=3 SV=1
4	Q6DBN1	5.05e-06	52.4	243	0.016	0.119	Y4845_ARATH BTB/POZ domain-containing protein At4g08455 OS=Arabidopsis thaliana OX=3702 GN=At4g08455 PE=1 SV=1
5	O94955	5.49e-05	50.4	611	0.023	0.069	RHBT3_HUMAN Rho-related BTB domain-containing protein 3 OS=Homo sapiens OX=9606 GN=RHOBTB3 PE=1 SV=2
6	Q9CTN4	7.93e-05	50.1	611	0.023	0.069	RHBT3_MOUSE Rho-related BTB domain-containing protein 3 OS=Mus musculus OX=10090 GN=Rhobtb3 PE=2 SV=3
7	Q99LJ7	1.34e-04	49.3	551	0.018	0.060	RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rcbtb2 PE=1 SV=1
8	O95199	4.19e-04	47.8	551	0.020	0.065	RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RCBTB2 PE=1 SV=1
9	Q7ZVG0	8.94e-04	46.6	531	0.018	0.062	Q7ZVG0_DANRE RCC1 and BTB domain-containing protein 1 OS=Danio rerio OX=7955 GN=wu:fj43a07 PE=1 SV=1
10	B8A4R1	0.001	46.2	531	0.018	0.062	B8A4R1_DANRE RCC1 and BTB domain-containing protein 1 isoform X1 OS=Danio rerio OX=7955 GN=fj43a07 PE=1 SV=1
11	B9DHT4	0.002	45.4	710	0.019	0.048	ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana OX=3702 GN=ARIA PE=1 SV=2
12	Q8NDN9	0.002	45.4	531	0.017	0.058	RCBT1_HUMAN RCC1 and BTB domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RCBTB1 PE=1 SV=1
13	P34147	0.004	44.7	598	0.017	0.052	RACA_DICDI Rho-related protein racA OS=Dictyostelium discoideum OX=44689 GN=racA PE=1 SV=2
14	B7U179	0.005	44.3	737	0.022	0.054	ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana OX=3702 GN=ABAP1 PE=1 SV=1
15	Q9VFP2	0.057	40.8	829	0.016	0.036	RDX_DROME Protein roadkill OS=Drosophila melanogaster OX=7227 GN=rdx PE=1 SV=2
16	Q6IQ16	0.059	40.4	392	0.015	0.071	SPOPL_HUMAN Speckle-type POZ protein-like OS=Homo sapiens OX=9606 GN=SPOPL PE=1 SV=1
17	O74881	0.10	40.0	1347	0.024	0.033	BTB1_SCHPO BTB/POZ domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=btb1 PE=1 SV=1
18	Q9VS48	0.12	39.7	1145	0.010	0.016	SLX4_DROME Structure-specific endonuclease subunit SLX4 OS=Drosophila melanogaster OX=7227 GN=mus312 PE=1 SV=2
19	Q7PLP4	0.52	37.7	1111	0.014	0.023	Q7PLP4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG41099 PE=1 SV=1
20	A8Y582	0.55	37.7	1122	0.014	0.023	A8Y582_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=GM10035 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	2.4e-09	48.8	BTB/POZ domain
2	PF09494 Slx4	5.1e-10	50.4	Slx4 endonuclease
3	PF13920 zf-C3HC4_3	2e+02	13.3	Zinc finger, C3HC4 type (RING finger)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294008

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000013807	0.999	DNA excision repair protein ERCC-1
2	9606.ENSP00000251303	0.999	SLX1 structure-specific endonuclease subunit homolog A (S. cerevisiae)
3	9606.ENSP00000307853	0.999	Crossover junction endonuclease MUS81
4	9606.ENSP00000328940	0.999	Structure-specific endonuclease subunit SLX1
5	9606.ENSP00000287647	0.997	Fanconi anemia group D2 protein
6	9606.ENSP00000254942	0.991	Telomeric repeat-binding factor 2
7	9606.ENSP00000310520	0.991	DNA repair endonuclease XPF
8	9606.ENSP00000376952	0.990	Crossover junction endonuclease EME1
9	9606.ENSP00000233146	0.986	DNA mismatch repair protein Msh2
10	9606.ENSP00000261584	0.982	Partner and localizer of BRCA2
11	9606.ENSP00000310842	0.981	Fanconi anemia group I protein
12	9606.ENSP00000336701	0.981	DNA repair protein RAD51 homolog 3
13	9606.ENSP00000369497	0.981	Breast cancer type 2 susceptibility protein
14	9606.ENSP00000418960	0.978	Breast cancer type 1 susceptibility protein
15	9606.ENSP00000372088	0.965	DNA repair protein RAD51 homolog 1
16	9606.ENSP00000317039	0.964	RecQ-mediated genome instability protein 1
17	9606.ENSP00000259008	0.963	Fanconi anemia group J protein
18	9606.ENSP00000310356	0.958	RecQ-mediated genome instability protein 2
19	9606.ENSP00000343526	0.957	Ubiquitin carboxyl-terminal hydrolase 1
20	9606.ENSP00000278616	0.956	Serine-protein kinase ATM

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008047	1.000	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051716	0.996	cellular response to stimulus
GO:0044260	0.996	cellular macromolecule metabolic process
GO:0090304	0.995	nucleic acid metabolic process
GO:0051052	0.993	regulation of DNA metabolic process
GO:0051276	0.990	chromosome organization
GO:0033043	0.987	regulation of organelle organization
GO:0031325	0.985	positive regulation of cellular metabolic process
GO:0032200	0.982	telomere organization
GO:0051173	0.980	positive regulation of nitrogen compound metabolic process
GO:0006950	0.979	response to stress
GO:0006259	0.979	DNA metabolic process
GO:0010604	0.977	positive regulation of macromolecule metabolic process
GO:0032204	0.976	regulation of telomere maintenance
GO:0045935	0.974	positive regulation of nucleobase-containing compound metabolic process
GO:0000723	0.965	telomere maintenance
GO:0006974	0.960	cellular response to DNA damage stimulus
GO:0051054	0.958	positive regulation of DNA metabolic process
GO:0006302	0.952	double-strand break repair
GO:0051130	0.945	positive regulation of cellular component organization
GO:0006310	0.942	DNA recombination
GO:2001252	0.936	positive regulation of chromosome organization
GO:0032206	0.906	positive regulation of telomere maintenance
GO:0048523	0.891	negative regulation of cellular process
GO:0051172	0.834	negative regulation of nitrogen compound metabolic process
GO:0031324	0.834	negative regulation of cellular metabolic process
GO:0000724	0.813	double-strand break repair via homologous recombination
GO:0010605	0.812	negative regulation of macromolecule metabolic process
GO:0045934	0.779	negative regulation of nucleobase-containing compound metabolic process
GO:0051053	0.548	negative regulation of DNA metabolic process
GO:0022607	0.469	cellular component assembly
GO:2001251	0.415	negative regulation of chromosome organization
GO:0006289	0.378	nucleotide-excision repair
GO:0032205	0.315	negative regulation of telomere maintenance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:1905348	0.998	endonuclease complex
GO:0140513	0.998	nuclear protein-containing complex
GO:0000781	0.996	chromosome, telomeric region
GO:0000109	0.993	nucleotide-excision repair complex
GO:0000785	0.991	chromatin
GO:0000228	0.990	nuclear chromosome
GO:1905347	0.988	endodeoxyribonuclease complex
GO:0030054	0.977	cell junction
GO:0033557	0.763	Slx1-Slx4 complex
GO:0070522	0.760	ERCC4-ERCC1 complex
GO:0048476	0.756	Holliday junction resolvase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]