StarFunc result for job id Q8IYA2

User Input

>input (1237 residues)
MVSWGGEKRGGAEGSPKPAVYATRKTGSVRSQEDQWYLGYPGDQWSSGFSYSWWKNSVGS
ESKHGEGALDQPQHDVRLEDLGELHRAARSGDVPGVEHVLVPGDTGVDKRDRKKSIQQLV
PEYKEKQTPESLPQNNNPDWHPTNLTLSDETCQRSKNLKVDDKCPSVSPSMPENQSATKE
LGQMNLTEREKMDTGVKTSQEPEMAKDCDREDIPIYPVLPHVQKSEEMRIEQGKLEWKNQ
LKLVINELKQRFGEIYEKYKIPACPEEEPLLDNSTRGTDVKDIPFNLTNNIPGCEEEDAS
EISVSVVFETFPEQKEPSLKNIIHSYYHPYSGSQEHVCQSSSKLHLHENKLDCDNDNKPG
IGHIFSTDKNFHNDASTKKARNPEVVTVEMKEDQEFDLQMTKNMNQNSDSGSTNNYKSLK
PKLENLSSLPPDSDRTSEVYLHEELQQDMQKFKNEVNTLEEEFLALKKENVQLHKEVEEE
MEKHRSNSTELSGTLTDGTTVGNDDDGLNQQIPRKENGEHDRLALKQENEEKRNADMLYN
KDSEQLRIKEEECGKVVETKQQLKWNLRRLVKELRTVVQERNDAQKQLSEEQDARILQDQ
ILTSKQKELEMAQKKRNPEISHRHQKEKDLFHENCMLQEEIALLRLEIDTIKNQNKQKEK
KYFEDIEVVKEKNDNLQKIIKRNEETLTETILQYSGQLNNLTAENKMLNSELENGKENQE
RLEIEMESYRCRLAAAVHDCDQSQTARDLKLDFQRTRQEWVRLHDKMKVDMSGLQAKNEI
LSEKLSNAESKINSLQIQLHNTRDALGRESLILERVQRDLSQTQCQKKETEQMYQSKLKK
YIAKQESVEERLSQLQSENMLLRQQLDDVHKKANSQEKTISTIQDQFHSAAKNLQAESEK
QILSLQEKNKELMDEYNHLKERMDQCEKEKAGRKIDLTEAQETVPSRCLHLDAENEVLQL
QQTLFSMKAIQKQCETLQKNKKQLKQEVVNLKSYMERNMLERGEAEWHKLLIEERARKEI
EEKLNEAILTLQKQAAVSHEQLAQLREDNTTSIKTQMELTVIDLESEISRIKTSQADFNK
TKLERYKELYLEEVKVRESLSNELSRTNEMIAEVSTQLTVEKEQTRSRSLFTAYATRPVL
ESPCVGNLNDSEGLNRKHIPRKKRSALKDMESYLLKMQQKLQNDLTAEVAGSSQTGLHRI
PQCSSFSSSSLHLLLCSICQPFFLILQLLLNMNLDPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UPS8	0.085	0.066	7.610E-48	1710	0.409	0.296	Q9UPS8.pdb.gz	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
2	AFDB:Q811D2	0.118	0.098	7.526E-40	1581	0.343	0.268	Q811D2.pdb.gz	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
3	AFDB:Q8N2N9	0.151	0.140	2.171E-20	1353	0.222	0.203	Q8N2N9.pdb.gz	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
4	AFDB:Q6ZQ06	0.076	0.068	1.743E-12	1403	0.159	0.140	Q6ZQ06.pdb.gz	CE162_MOUSE Centrosomal protein of 162 kDa OS=Mus musculus OX=10090 GN=Cep162 PE=1 SV=2
5	AFDB:Q5TB80	0.078	0.071	2.301E-12	1403	0.158	0.139	Q5TB80.pdb.gz	CE162_HUMAN Centrosomal protein of 162 kDa OS=Homo sapiens OX=9606 GN=CEP162 PE=1 SV=2
6	AFDB:E7F5E1	0.088	0.081	3.257E-12	1367	0.150	0.136	E7F5E1.pdb.gz	CE162_DANRE Centrosomal protein of 162 kDa OS=Danio rerio OX=7955 GN=cep162 PE=2 SV=1
7	AFDB:B9EKI3	0.104	0.117	1.831E-10	1091	0.154	0.175	B9EKI3.pdb.gz	TMF1_MOUSE TATA element modulatory factor OS=Mus musculus OX=10090 GN=Tmf1 PE=1 SV=2
8	AFDB:A0A024R370	0.075	0.083	9.050E-10	1093	0.141	0.159	A0A024R370.pdb.gz
9	AFDB:Q9PTD7	0.098	0.089	3.631E-9	1360	0.174	0.158	Q9PTD7.pdb.gz	CING_XENLA Cingulin OS=Xenopus laevis OX=8355 GN=cgn PE=1 SV=3
10	AFDB:Q57YV4	0.083	0.096	2.723E-8	1028	0.127	0.153	Q57YV4.pdb.gz	Q57YV4_TRYB2 Kinetoplast-associated protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.440 PE=4 SV=1
11	PDB:7r5jV0	0.042	0.172	3.008	273	0.035	0.158	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:7r5jW0	0.051	0.082	4.892	735	0.023	0.038	7r5jW0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
13	PDB:5n9jG	0.033	0.210	6.459	163	0.019	0.141	5n9jG.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UPS8	1.63e-151	499	1710	0.227	0.164	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
2	Q811D2	3.02e-116	399	1581	0.182	0.142	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
3	Q5TYW2	7.60e-75	268	823	0.157	0.236	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
4	Q8N2N9	5.86e-67	250	1353	0.146	0.134	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
5	A0JP26	4.33e-30	129	581	0.076	0.162	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
6	A5A3E0	4.64e-28	125	1075	0.068	0.078	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
7	P0CG39	2.01e-27	123	1038	0.067	0.080	POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens OX=9606 GN=POTEJ PE=3 SV=1
8	Q6S8J3	2.14e-27	123	1075	0.068	0.078	POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens OX=9606 GN=POTEE PE=2 SV=3
9	P0CG38	6.16e-27	121	1075	0.067	0.077	POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens OX=9606 GN=POTEI PE=3 SV=1
10	Q96IX9	2.88e-26	107	119	0.049	0.504	A26L1_HUMAN Putative ankyrin repeat domain-containing protein 26-like 1 OS=Homo sapiens OX=9606 GN=ANKRD36BP1 PE=5 SV=1
11	Q99104	0.13	39.3	1853	0.043	0.029	MYO5A_MOUSE Unconventional myosin-Va OS=Mus musculus OX=10090 GN=Myo5a PE=1 SV=2
12	Q9QYF3	0.20	38.5	1828	0.044	0.030	MYO5A_RAT Unconventional myosin-Va OS=Rattus norvegicus OX=10116 GN=Myo5a PE=1 SV=1
13	Q7TT50	0.24	38.1	1713	0.076	0.055	MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus OX=10090 GN=Cdc42bpb PE=1 SV=2
14	Q9Y5S2	0.42	37.4	1711	0.075	0.054	MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2
15	Q9Y4I1	0.56	37.0	1855	0.043	0.029	MYO5A_HUMAN Unconventional myosin-Va OS=Homo sapiens OX=9606 GN=MYO5A PE=1 SV=2
16	Q03427	0.82	36.2	621	0.037	0.074	LAMC_DROME Lamin-C OS=Drosophila melanogaster OX=7227 GN=LamC PE=1 SV=2
17	Q9P1Z2	1.8	35.4	691	0.046	0.082	CACO1_HUMAN Calcium-binding and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CALCOCO1 PE=1 SV=2
18	Q7TT49	3.0	34.7	1713	0.075	0.054	MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus OX=10116 GN=Cdc42bpb PE=1 SV=1
19	A2AL36	3.1	34.7	2334	0.040	0.021	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
20	Q9P219	3.2	34.7	2028	0.058	0.036	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14915 CCDC144C	7.3e-125	427.7	CCDC144C protein coiled-coil region
2	PF12001 DUF3496	2.1e-39	145.7	Domain of unknown function (DUF3496)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353717

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000410111	0.642	TBC1 domain family member 26
2	9606.ENSP00000437812	0.632	Protein FAM106A
3	9606.ENSP00000312141	0.630	Zinc finger protein 654
4	9606.ENSP00000382000	0.630	CMT1A duplicated region transcript 15 like 2
5	9606.ENSP00000339973	0.619	TBC1 domain family member 28
6	9606.ENSP00000329522	0.605	Speedy protein E4
7	9606.ENSP00000269127	0.582	Uncharacterized protein C17orf64
8	9606.ENSP00000456861	0.574	TBC1 domain family member 3G
9	9606.ENSP00000379242	0.567	CMT1A duplicated region transcript 1 protein
10	9606.ENSP00000297307	0.561	Solute carrier family 35 member G3
11	9606.ENSP00000331466	0.561	Transmembrane protein 95
12	9606.ENSP00000396523	0.561	Solute carrier family 35 member G6
13	9606.ENSP00000352172	0.558	V-set and immunoglobulin domain containing 10
14	9606.ENSP00000386180	0.556	Olfactory receptor 3A2
15	9606.ENSP00000286398	0.547	Structural maintenance of chromosomes protein 2
16	9606.ENSP00000367157	0.542	Leucine-rich repeat-containing protein 3C
17	9606.ENSP00000330051	0.537	Major facilitator superfamily domain containing 6 like
18	9606.ENSP00000462799	0.533	TBC1 domain family member 29
19	9606.ENSP00000484556	0.521	TBC1 domain family member 3B
20	9606.ENSP00000301037	0.518	Uncharacterized serine/threonine-protein kinase SgK494

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.930	biological regulation
GO:0050789	0.923	regulation of biological process
GO:0009987	0.897	cellular process
GO:0050794	0.886	regulation of cellular process
GO:0051128	0.420	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.997	organelle
GO:0005622	0.997	intracellular anatomical structure
GO:0043229	0.991	intracellular organelle
GO:0043232	0.895	intracellular non-membrane-bounded organelle
GO:0005856	0.827	cytoskeleton
GO:0016020	0.367	membrane
GO:0015630	0.364	microtubule cytoskeleton
GO:0005815	0.320	microtubule organizing center
GO:0043227	0.314	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]